KEGG   Corynebacterium pseudotuberculosis 258: Cp258_1908Help
Entry
Cp258_1908        CDS       T02118                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
coe  Corynebacterium pseudotuberculosis 258
Pathway
coe00010  Glycolysis / Gluconeogenesis
coe00071  Fatty acid degradation
coe00350  Tyrosine metabolism
coe00625  Chloroalkane and chloroalkene degradation
coe00626  Naphthalene degradation
coe01100  Metabolic pathways
coe01110  Biosynthesis of secondary metabolites
coe01120  Microbial metabolism in diverse environments
coe01130  Biosynthesis of antibiotics
coe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:coe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp258_1908
  Lipid metabolism
   00071 Fatty acid degradation
    Cp258_1908
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cp258_1908
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cp258_1908
   00626 Naphthalene degradation
    Cp258_1908
Enzymes [BR:coe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cp258_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short Methyltransf_25 TrkA_N Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AFK17525
Position
complement(2103741..2104778)
Genome map
AA seq 345 aa AA seqDB search
MKTDFPEAFTAAVVDNFGPELNIHDVVLPEPGPNQALVKLVASGICHTDLHAAEGDWPVK
PEPPFVPGHEGVGEVVKLGPGHHRVQLGDMVGNVWLWSACGECEYCRAGRETLCNDAEYG
GYTVDGSFGEYMLVDTRYCARIPEGSGPVEVAPILCAGVTVYKGLKETECKPGQYMVISG
IGGLGHIAVQYAVAMGMRVIAVDIADEKLELARKHGAEFAVNALKEDPVESINAFTSGGA
HGVLVTAVHPQAFGQAIGMARKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQD
LEEALDFYARGMIKPTVTECKLGDVNSVFADMHKGKVDGRMAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgatttccctgaggccttcaccgccgctgtagttgacaactttggccctgaa
ctcaatatccacgatgttgttttgcccgagccgggacctaatcaggcattggtaaagctg
gtggcctctggcatttgccatacagatcttcatgcggcggaaggggactggccggtaaaa
cccgagccgccttttgtccccgggcatgaaggcgtgggggaagttgtgaaattgggaccc
ggccatcatcgcgtgcaacttggagacatggtgggcaacgtttggctttggtccgcctgt
ggggagtgcgagtactgccgcgccggacgtgaaaccctttgcaatgacgccgaatatggc
ggatatacggtcgacggttcttttggcgaatacatgctggtagatacccgctactgtgcg
cgtattccagaaggctccggtccagttgaagtggcccccatcttgtgtgccggcgtgacc
gtgtacaaaggcctcaaagaaaccgagtgtaagccggggcagtacatggtgatttccggc
atcggtggcctggggcatatcgctgtgcagtatgcggtggctatgggaatgcgagtgatc
gctgtggatattgcggatgagaaactcgagctggcgcgtaagcacggtgcagaatttgca
gtcaatgcgttgaaggaagacccggttgagtcgatcaacgcatttacctcaggtggtgcg
catggcgttttggtcactgccgtgcacccgcaggcgtttggacaagccatcgggatggcc
agaaaaggcggaaccatcgtatttaatgggcttcctccaggagagttcccggcaccgatt
tttgagattgtgttcaaggggctaactattcgcggttcattggtgggaacgcgccaggac
ctagaagaagccctggatttctatgcacgcggaatgatcaaaccgaccgttacggaatgc
aagcttggcgacgtcaacagtgtcttcgccgatatgcataaaggcaaggttgatggtcgc
atggctattaggtattaa

DBGET integrated database retrieval system