KEGG   Comamonas sp. NLF 7-7: FOZ74_04365Help
Entry
FOZ74_04365       CDS       T06146                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cof  Comamonas sp. NLF 7-7
Brite
KEGG Orthology (KO) [BR:cof00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FOZ74_04365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: QEA12330
UniProt: A0A5B8RRW1
Position
complement(870333..871343)
Genome map
AA seq 336 aa AA seqDB search
MDTVQTALWVVTLLVALAIAFDFMNGFHDAANSIATVVSTGVLKPTQAVLFAAFFNVVAV
FVFHLSVAATIGKGIVDIHVVDTHVVFGALVGAITWNVITWYYGIPSSSSHALIGGIVGA
VIAKTGAEALVASGIFKIVVFIFVSPLLGFALGSMMMVLMAWLLRRVRPQRVDRWFRRLQ
LVSAGAYSLGHGGNDAQKTIGIVWLLLIATGYASASDAEPPLWVIGACYSAMGLGTMFGG
WRIVKTMGQKITKLKPVGGFCAETGGAMSLFLATWLGIPVSTTHTITGAIVGVGSTQRAS
AVRWGVAGNIVWAWILTIPASAFVAGVAYLISLQLY
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggataccgtacagaccgccctgtgggtcgtgaccctgctggtggcgctggccatcgcc
ttcgacttcatgaacggctttcacgatgcggccaactcgatcgccaccgtggtctccacc
ggcgtgctcaagcccacgcaggcggtgctgttcgccgccttcttcaacgtggtggcggtc
ttcgtcttccacctgagcgtggcggccaccataggcaagggcatcgtggacatccacgtg
gtggacacgcacgtggtcttcggcgcgctggtgggcgccatcacctggaacgtcatcacc
tggtactacggcatacccagcagctcatcgcatgcgctgatcggcggcatcgtcggcgcg
gtgatcgccaagaccggggccgaggcgctggtggccagcggcatcttcaagatcgtggtg
ttcatcttcgtctcgccgctgctgggctttgcgctgggctccatgatgatggtgctcatg
gcctggctgctcaggcgcgtgcgcccgcagcgggtggaccggtggtttcggcgcctgcag
ctggtctcggccggcgcctacagcctggggcacggcggcaacgacgcgcaaaagaccata
ggcatcgtctggctgctcttgattgccaccggctacgcctcggcctcggacgccgagccg
ccgctgtgggtcatcggcgcctgctattcggcgatggggctgggcaccatgttcggcggc
tggcgcatcgtcaagaccatggggcagaagatcaccaagctcaagcccgtggggggcttt
tgcgccgagaccggcggcgcgatgtcgctgttcctcgcgacatggctgggcataccggtg
tcgaccacgcacaccatcaccggcgccatcgtcggcgtcggctcgacccagcgcgccagc
gcggtgcgctggggcgtggcgggcaacatcgtctgggcctggatcctgacgattccggcc
agcgccttcgtcgccggcgtggcctatctcatcagtctgcagctctactga

DBGET integrated database retrieval system