KEGG   Comamonas sp. NLF 7-7: FOZ74_08315Help
Entry
FOZ74_08315       CDS       T06146                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K18365  4-hydroxy-2-oxovalerate/4-hydroxy-2-oxohexanoate aldolase [EC:4.1.3.39 4.1.3.43]
Organism
cof  Comamonas sp. NLF 7-7
Pathway
cof00362  Benzoate degradation
cof00621  Dioxin degradation
cof00622  Xylene degradation
cof01100  Metabolic pathways
cof01120  Microbial metabolism in diverse environments
cof01220  Degradation of aromatic compounds
Module
cof_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:cof00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FOZ74_08315 (dmpG)
   00622 Xylene degradation
    FOZ74_08315 (dmpG)
   00621 Dioxin degradation
    FOZ74_08315 (dmpG)
Enzymes [BR:cof01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     FOZ74_08315 (dmpG)
    4.1.3.43  4-hydroxy-2-oxohexanoate aldolase
     FOZ74_08315 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm DUF4410
Motif
Other DBs
NCBI-ProteinID: QEA13034
UniProt: A0A5B8RWE8
Position
1710052..1711086
Genome map
AA seq 344 aa AA seqDB search
MSIKGKKVTLHEMALRDGMHPKQHQISIEQMKAVATALDAAGMPLIEVTHGDGLGGDSVN
YGFAAHTDEQYLKAVIPLMKQAKVSALLLPGIGTVDHLKLAHEVGVHTIRVATHCTEADV
SEQHITMARKLGMDTVGFLMMSHMNSPEGLVKQAKLMEGYGANCIYVTDSAGHMLPEDVR
AKLGAVRGALKPETELGFHAHHNLAMGVANSITAIEMGANRVDAASAGLGAGAGNTPMEV
LVAVLDLMGVQTGVDVFKIQDVAEDLIVPMMDFPIRIDRDALTLGYAGVYGSFLLFAKRA
EKKYGVPAREILVEMGRRGCVGGQEDMIEDTALTLARQRGLKVA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaaaggcaagaaagtcaccctgcacgagatggcgctgcgcgacggcatgcac
cccaagcagcaccagatcagcatcgagcagatgaaggcggtcgccaccgcgctggacgcg
gccggcatgccgctgatcgaggtcacccatggggacggcctggggggtgattcggtcaac
tacggctttgccgcgcacaccgacgagcaatacctcaaggcggtgatcccgctgatgaag
caggccaaggtttcggccctgctgctgcccggcataggcaccgtcgatcacctgaagctg
gcgcacgaggtcggcgtgcacaccatccgcgtggccacccattgcaccgaggcggacgtc
tccgagcagcacatcaccatggcgcgcaagctcggcatggacaccgtgggctttctgatg
atgagccacatgaacagccccgagggcctggtcaagcaggcgaagctgatggaaggctac
ggcgccaactgcatctacgtcaccgactcggccggtcacatgctgcccgaggatgtgcgc
gccaagctcggcgcggtgcggggcgcgctcaagcccgagacggaactcggctttcacgcg
caccacaacctcgccatgggcgtggccaactccatcaccgcgatcgagatgggcgccaat
cgggtggatgcggccagtgccggtctgggcgcgggcgcgggcaacacgccgatggaggtg
ctggtcgcggtgctcgacctgatgggcgtgcaaaccggcgtggacgtgttcaagatccag
gacgtggccgaagacctgatcgtgccgatgatggacttccccatccgcatcgaccgcgat
gcgctcacgctgggctacgcgggtgtctacggttccttcctgctgttcgccaagcgcgcc
gagaagaagtacggcgtgcccgcgcgcgagatcctcgtcgagatggggcgccggggctgc
gtcggcgggcaggaagacatgatcgaggacaccgcgctcacgctcgcgcgccagcgcggc
ctgaaggtggcctga

DBGET integrated database retrieval system