KEGG   Cohnella sp. 18JY8-7: EAV92_04690Help
Entry
EAV92_04690       CDS       T05696                                 

Definition
(GenBank) NAD-dependent malic enzyme
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
coh  Cohnella sp. 18JY8-7
Pathway
coh00620  Pyruvate metabolism
coh01200  Carbon metabolism
coh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:coh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAV92_04690
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EAV92_04690
Enzymes [BR:coh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     EAV92_04690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ACT_4 ThiF ACT 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AYQ75497
UniProt: A0A3G3K5Z9
Position
1022831..1024240
Genome map
AA seq 469 aa AA seqDB search
MSGGKSVIIRLEMQTDRIHFGQVASAVAEAGGDIVAIDVIQTGRDTTIRDLTVMVADDGH
TNRIADGLKALSGIRVVNVSDRTFLLHLGGKIEITPKTPIQNRDDLSRVYTPDVARVCMA
IREDPDKAFALTVKRNTVAVVSDGTAVLGLGNIGPYAAMPVMEGKAMLFKQFAGVDAFPI
CLDTQDPEEIIRHVKAIAPAFGGINLEDISSPRCFEIEKRLREELDIPVFHDDQHGTAVV
LYAGLINALKVVGKDLGSAKVVVCGVGAAGVACSKILMAAGVGEIIGVDRDGILTADREY
AQPMWRWYAEHSNPRRISGGLREALEGADVFIGLSAGGLLKREYVMRMARDPIVFAMANP
TPEISPEEAEDIVGVIATGRSDYPNQINNVLCFPGIFRGALDCRASEINEEMKLAAAEAI
ASVIRDEERNKQYIIPSVFNQEVVKRLRDGVVEAAIRTGVARRIPREYR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcggcaaaagcgtcattatccggcttgaaatgcaaacggaccggatccatttc
ggccaggtggcaagcgcggtcgcggaggcgggcggggatatcgtcgccatcgacgtcatc
cagaccgggcgggatacgacgatccgggatttgaccgtcatggtggcggacgacggccac
acgaaccgcatcgcggacggcttgaaggcattaagcggaattcgcgtcgtcaacgtctcg
gaccggacgttcctgctgcatctcggcggcaaaatcgaaatcacgcccaaaacgccgatc
caaaaccgcgacgatctgtccagggtctatacgccggacgtcgcccgcgtttgcatggcg
atccgcgaagacccggacaaagcgttcgccctgacggttaagcgcaatacggtcgccgtc
gtgtcggacggcacggccgtgctcggtctcggcaacatcgggccgtacgcggccatgccg
gtgatggaaggcaaggcgatgctgttcaagcagttcgccggcgtcgacgcctttccgatc
tgcctcgatacgcaggatccggaagaaatcatccgccacgtcaaggccatcgctccggcg
ttcgggggcatcaatctcgaggatatctcgtcgccccgctgcttcgaaatcgagaagagg
ctgcgggaagagctcgacattccggtcttccacgacgaccagcacggcacggccgtcgta
ctttacgcgggtttgattaacgcgctgaaggtggtcggcaaggacctcggcagcgcgaag
gtggtcgtgtgcggcgtcggggcggcgggcgttgcctgcagcaagattctgatggccgcc
ggcgtcggggaaatcatcggcgtggaccgggacggtatcttgacggccgatcgggaatac
gcgcagccgatgtggcgctggtacgcggagcattcgaacccgaggcggatcagcgggggg
ttgcgggaagcgctggagggagcggacgtgttcatcgggttgtccgccggcggcctcctc
aagcgggagtacgtcatgcggatggcccgggatccgatcgtcttcgcgatggcgaatccc
acgcccgagatttccccggaggaagcggaggacatcgtcggcgtcatcgccacggggcgt
tccgactatccgaaccagatcaacaacgtgctgtgcttccccggcattttccggggggcg
ctggattgcagggcttcggagatcaacgaggaaatgaagctggccgccgcggaagcgatc
gcttccgtcatccgggacgaagagcgcaacaagcagtacatcattccgagcgtcttcaac
caggaagtcgtgaagaggctccgcgacggcgtcgtggaggccgcgatccgcacgggcgtc
gcgcgccgcatccccagggaatatcggtag

DBGET integrated database retrieval system