KEGG   Cohnella sp. 18JY8-7: EAV92_04955Help
Entry
EAV92_04955       CDS       T05696                                 

Gene name
trmFO
Definition
(GenBank) FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))-methyltransferase TrmFO
  KO
K04094  methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
coh  Cohnella sp. 18JY8-7
Brite
KEGG Orthology (KO) [BR:coh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:coh03016]
    EAV92_04955 (trmFO)
   03036 Chromosome and associated proteins [BR:coh03036]
    EAV92_04955 (trmFO)
Enzymes [BR:coh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     EAV92_04955 (trmFO)
Transfer RNA biogenesis [BR:coh03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    EAV92_04955 (trmFO)
Chromosome and associated proteins [BR:coh03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    EAV92_04955 (trmFO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA NAD_binding_8 Pyr_redox_2 DAO 3HCDH_N AlaDh_PNT_C Pyr_redox FAD_binding_2 HI0933_like FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AYQ71970
UniProt: A0A3G3JUP9
Position
1072561..1073901
Genome map
AA seq 446 aa AA seqDB search
MNEHPRVTVVGAGLAGSEAAWQIASQGVPVTLYEMRPARRTPAHHTDKFAELVCSNSLRA
NGLTNAVGVLKEEMRRLNSLILSAADRNAVPAGGALAVDRDGFSGEVTSRLRNHPLITVV
NEELSAIPEDGITVIATGPLTSPDLSKQIQELLGEEYFYFYDAAAPIVEKDSIDMERVFL
ASRYDKGEAAYLNCPMNEEEFEAFYEALITAETAEIKDFEKEMYFEGCMPIEVMAKRGKQ
TVLFGPMKPVGLVDPRTGKQPHAVVQLRQDNAAGTLYNLVGFQTHLKWGEQKRVFGLIPG
LEQAEFVRFGVMHRNTFINSPRLMLPTYQFKRRESLFFAGQMTGVEGYVESAASGLIAGL
NAGRLARGLDPVTLPAETTLGSMAHYITTADFRHFQPMNANFGLFPPLGHRVRSKKEKND
TIAERALAAIEDFAREWQTDASIPTV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgaacatccacgcgtgacggtcgtcggagccggtcttgccggcagcgaagcggct
tggcagatcgcctcccaaggcgtccccgtcacgctttacgaaatgcggcccgctcgccgt
acgcccgcccaccacaccgacaagttcgccgagctggtgtgcagcaacagcctccgggca
aacggcttgacgaacgcggtcggcgtgttgaaggaagagatgcgccggctgaattcgctg
attctctcggcggcggaccggaacgcggtgccggcgggcggcgcgctcgcggtggaccgc
gacggattctccggggaagtcacgagccgtttgcggaatcatccgttgattacggtcgta
aacgaagagctttcggccattcccgaggacgggataacggtaatcgccaccggtccgctg
acctcgccggatctgtccaagcaaatccaggaactgctcggcgaagagtatttttacttc
tacgacgcggcggctccgatcgtggagaaggattccatcgacatggagcgggttttcctc
gcgtcccgttacgacaagggcgaggcggcttacctgaattgccccatgaacgaggaagaa
ttcgaagcgttctacgaggcgctgatcacggcggaaaccgcggagatcaaagatttcgag
aaggaaatgtacttcgaaggctgcatgccgatcgaggtcatggccaaacgcggcaaacag
acggtgctgttcggaccgatgaaaccggtcgggctggtcgatccccgtacgggcaagcag
cctcacgccgtcgtgcagctccggcaggacaacgcggccggtacgctgtacaacctggtc
ggcttccagacccatctcaaatggggagagcagaaaagggtgttcggcctcattccggga
ctggagcaggcggaattcgtacgctttggcgtcatgcaccgcaatacgttcatcaactcg
ccgcggctgatgctcccgacctatcagttcaagcggagggagagcctgttcttcgccggc
caaatgaccggcgtcgaagggtacgtggaatccgcggcgtccggcctgatcgccggcttg
aacgccgggcggctcgcgcgcgggctggatcccgtgacgctgccggcggagacgacgctc
ggcagcatggcgcactatatcacgacggcggatttccgccatttccaaccgatgaacgcg
aatttcggtttgttcccgcccttggggcatcgagttcgcagcaaaaaagagaaaaacgac
accatcgcggaacgggcgcttgcggcaattgaagatttcgcccgcgaatggcagacggat
gcaagcattccgaccgtatga

DBGET integrated database retrieval system