KEGG   Cohnella candidum: EAV92_09155Help
Entry
EAV92_09155       CDS       T05696                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
coh  Cohnella candidum
Pathway
coh00230  Purine metabolism
coh00240  Pyrimidine metabolism
coh01100  Metabolic pathways
coh01110  Biosynthesis of secondary metabolites
Module
coh_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
coh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
coh_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:coh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EAV92_09155
   00240 Pyrimidine metabolism
    EAV92_09155
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:coh04131]
    EAV92_09155
Enzymes [BR:coh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     EAV92_09155
Membrane trafficking [BR:coh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    EAV92_09155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AYQ72717
UniProt: A0A3G3JXY6
Position
complement(1947457..1947900)
Genome map
AA seq 147 aa AA seqDB search
MERTYLMIKPDGVQRGLIGEIVGRFERKGLKLIGAKLMQVSVETAERHYAEHVGKDFYPP
LLEFITSSPVFAMVWEGDNAVAQARVLIGKTNSLEADPGTIRSDFALHTRFNLIHGSDSV
ENAEREISIFFQENELVSYDKAIQAWI
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggaacggacctatttgatgatcaaacccgacggagtgcagcgcggcttgatcggcgaa
atcgtcggccgcttcgaacgcaaaggccttaagctgatcggcgccaagctgatgcaggtt
tccgtcgaaacggcggaacgccattacgcggaacatgtcggcaaggatttctacccgccg
ctgctcgaattcatcacttcttccccggtattcgccatggtttgggaaggcgacaacgcg
gtcgcccaagcccgcgttctgatcggcaagaccaactctctggaagccgatccgggcacg
attcgcagcgacttcgccctacatacgagattcaatctgatccacggctcggactcagtc
gagaacgccgagcgcgaaatatccattttctttcaagaaaatgagctggtttcatacgat
aaagcgatccaagcctggatctga

DBGET integrated database retrieval system