KEGG   Cohnella sp. 18JY8-7: EAV92_22100Help
Entry
EAV92_22100       CDS       T05696                                 

Definition
(GenBank) 2,3-diaminopropionate biosynthesis protein SbnB
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
coh  Cohnella sp. 18JY8-7
Pathway
coh00998  Biosynthesis of secondary metabolites - other antibiotics
coh00999  Biosynthesis of secondary metabolites - unclassified
coh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coh00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    EAV92_22100
   00999 Biosynthesis of secondary metabolites - unclassified
    EAV92_22100
Enzymes [BR:coh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     EAV92_22100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: AYQ75011
UniProt: A0A3G3K4C3
Position
complement(4773862..4774824)
Genome map
AA seq 320 aa AA seqDB search
MLILNDGDIRSLGVNWGTLADCVERALLAREAGDYAQPIKPYLRYGDPRNRIIAMPAYLG
GEFDTAGIKWIASFPGNRDRGLPRAHGVIVLNRADTGEPYAILNGGMANVLRTAAVSGVV
LGRYLKARPREKLRVSIIGWGPIGRAHFEMCAALYGDVIEGFTLYDIGGVDESSIPVPWR
GRTAVASSWEEAYEPCDVFITCTVSSNRYIDRTPSKGSLLLHVSLRDYRAEALQDIQAVI
VDDWDEVCRENTDIELLHREAGLTRQQTRSLADLVCRDALADFPPEEPVLFCPMGMAIFD
LAVAGCLVKEARSAGAGIEV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgttgatcttaaacgacggggatatacgttctctcggcgtcaactggggcacgttggcc
gattgcgtggaacgagcgctgcttgcgagagaggccggcgattacgcgcagccgatcaag
ccttatttgcggtacggggatccccgcaaccgcatcatcgccatgcccgcttacctgggc
ggggaattcgatacggccggcatcaagtggatcgccagctttcccggcaaccgcgatcgg
gggcttccgagggctcacggcgtcatcgtgctgaatcgggcggacaccggcgagccctat
gccatcctgaacggcggcatggcgaacgtgctgcggacggcggcggtgagcggcgtcgtg
ctcggccgttacttgaaagcccgcccccgggagaagcttcgcgtctcgatcatcggctgg
gggccgatcgggcgcgcccacttcgagatgtgcgccgccttatacggcgacgttatcgag
gggttcacgctctacgacatcggcggcgtggatgagtcctccatccccgttccctggcgc
ggccggacggccgtggcttcgagctgggaggaagcgtatgaaccgtgcgatgttttcatc
acatgcacggtgtcttccaaccgttacatcgaccggacgccttccaagggcagcctgctt
ctccatgtgtctctccgggactatcgcgccgaagcgttgcaggatatccaagccgtcatc
gtcgacgactgggacgaagtgtgccgcgaaaacacggacatcgagctcctccaccgggaa
gccggcctgacccggcagcaaacgcgttcgctcgccgacctcgtctgccgggacgcgctt
gcggatttcccgccggaagagccggtactcttctgccccatgggcatggccatcttcgac
cttgccgtcgcgggctgcctcgtgaaagaagcccgctctgcgggagcgggcatagaagtt
taa

DBGET integrated database retrieval system