KEGG   Cohnella sp. 18JY8-7: EAV92_24195Help
Entry
EAV92_24195       CDS       T05696                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
coh  Cohnella sp. 18JY8-7
Brite
KEGG Orthology (KO) [BR:coh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EAV92_24195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AYQ75371
UniProt: A0A3G3K5B6
Position
5255850..5256851
Genome map
AA seq 333 aa AA seqDB search
MDLTMTLVVIIVILALGFDFINGFHDTANAIATAVSTRALTPRRAILLASAMNLLGALLF
TGVAKTIGGKVTDPFKLEHGLTVVIATLIAAIAWNLITWWRGLPSSSSHALIGALAGAAI
ASEGWDGINYGGFSSIVMGLVFSPIIAFVGGFIIMFVLKHLLANTSPHQVNKVFRKGQWL
TAAFQSFTHGTNDAQKAMGVITMALIAANVQTELEVPLWVKIAAALSMALGTSVGGWKII
KTMGTKIFKIEPINGFSADLSSASVILTATLTHFPVSTTHAITSSILGVGAAKKFNSVRW
DVAGRIIVTWIITIPIVAVLAALIYKVLSLFLP
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggatcttacaatgacattggttgtcatcatcgtcattctcgcgctcggcttcgacttc
atcaacggcttccacgacacggccaacgcgatcgcgacggccgtatcgacgcgcgcgctg
acgccccgcagggcgatcctcctggcgtccgcgatgaacctgctcggagcgctcttgttc
accggcgtcgcgaagacgatcgggggcaaggtgacggaccccttcaaactggaacacggg
ctgacggtcgtcatcgccacgctgatcgcggcgatcgcctggaacctgatcacctggtgg
agaggcctgccgtcttcttcttcccatgccctcatcggcgcgctggccggcgcggcgatc
gcttcggaaggctgggacggcattaactacggcggtttttccagcatcgtcatgggtctc
gtgttttcgccgatcatcgcattcgtcggcggcttcatcatcatgttcgtgttgaagcat
cttcttgcgaatacgagcccccatcaagtgaataaagtgttccgtaagggacaatggctg
acggcggcgttccaatcgttcacccacggtacgaacgacgcgcagaaggcgatgggcgtc
atcacgatggcgctgatcgcggcgaacgtccaaacggaactggaagtccccttgtgggtg
aaaatcgccgcggcgctgtccatggcactcggaacgtccgtcggcggctggaagatcatc
aagacgatgggcacgaaaattttcaaaatcgagccgatcaacggattttccgcggacctc
agctcggcatcggtcatcttgaccgcgacgttgacgcattttccggtcagcacgacgcat
gccatcacgtcctcgatcctcggcgtcggcgcggccaagaagttcaacagcgttcgctgg
gacgtcgcgggccgcattatcgtcacctggatcatcacgattccgatcgtggcggtgctg
gctgctctgatttacaaggtgctaagtttgttccttccctga

DBGET integrated database retrieval system