KEGG   Cohnella sp. HS21: KCTCHS21_22970Help
Entry
KCTCHS21_22970    CDS       T05979                                 

Definition
(GenBank) D-lyxose isomerase
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
cohn  Cohnella sp. HS21
Pathway
cohn00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:cohn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KCTCHS21_22970
Enzymes [BR:cohn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     KCTCHS21_22970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer DUF2917
Motif
Other DBs
NCBI-ProteinID: BBI32898
UniProt: A0A3T1D4C9
Position
2700961..2701506
Genome map
AA seq 181 aa AA seqDB search
MRRSELNHAKQRTADIFNQVGIRLTEEEASNIEIAWFGLNDLEKQGLELVTYVNSDRYCA
KELVLFPRQTCPEHLHPPVGADPGKQETFRCRAGKVWLYVEGEATANIQAIVPEGSEPYY
TVFHEIELNPGEQYTINPGIKHWFQGGPEGAVISEFSSTSRDENDIFTDPGIERMPTITE
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
ttgagaagaagcgaactaaaccatgctaaacaaagaacagctgatatttttaaccaggta
ggcattcgtttaacagaagaggaagcatcgaacattgagattgcatggttcgggttaaat
gacctggagaagcagggcttggagcttgttacttatgtgaattccgatcgttattgtgct
aaggagcttgtactattcccaagacaaacctgtccggagcatctgcatccgccagttggt
gcagacccaggtaaacaagaaacctttcgttgccgtgcaggcaaggtttggctctatgta
gagggagaagcgaccgctaatatccaagccatcgtccctgaaggcagtgagccttactat
accgtatttcatgagatcgagctgaatccaggagagcaatatacgattaatcctggcatt
aagcattggttccaaggtggtcctgaaggcgctgttatttctgaattctcaagcactagc
cgtgatgagaacgatatttttaccgatccgggaatcgaaagaatgcctacaataaccgaa
gattaa

DBGET integrated database retrieval system