KEGG   Cohnella sp. HS21: KCTCHS21_24480Help
Entry
KCTCHS21_24480    CDS       T05979                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cohn  Cohnella sp. HS21
Pathway
cohn00450  Selenocompound metabolism
cohn00970  Aminoacyl-tRNA biosynthesis
cohn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cohn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KCTCHS21_24480 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KCTCHS21_24480 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cohn01007]
    KCTCHS21_24480 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cohn03016]
    KCTCHS21_24480 (metG)
Enzymes [BR:cohn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     KCTCHS21_24480 (metG)
Amino acid related enzymes [BR:cohn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   KCTCHS21_24480 (metG)
Transfer RNA biogenesis [BR:cohn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KCTCHS21_24480 (metG)
 Prokaryotic type
   Other AARSs
    KCTCHS21_24480 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: BBI33049
UniProt: A0A3T1D4W4
Position
2867133..2869202
Genome map
AA seq 689 aa AA seqDB search
MTEANKSFYITTPIYYPSDKLHIGHAYTTVAGDAMARYKRLRGYNVRYLTGTDEHGQKIE
RKAEEAGKTPQQFVDDIVVGIKELWSKLEITNDDFIRTTEPRHTKVVQGIFTKLLEQGDI
YKGEYEGWYSISDETFYTETQLTDIVRNENGDVIGGKSPDSGHPVELVKEESYFFRMSKY
ADRLLAYYEENPDFIQPESRKTEMINNFIKPGLEDLAVSRTTFSWGVPVPGDPKHVIYVW
IDALSNYITALGYGTDSDELFRQYWPASVHLMSKEIVRFHTIYWPIMMMALDLPVPEKVF
AHGWLLMKDGKMSKSKGNVVDPVKLIEHFGLDAVRYYLLREVPFGADGAFTPEGFVERIN
YDLANDLGNLLNRTIAMIDKYFDGVLPNFELGITEFDGELEQTALSTIEKVEESLEKMEF
SVALSAIWTLVGRTNKYIDETKPWTLAKEESSKPALASVMGHLAESLRIVSILIQPFLTH
TPGLIWTQLGLEKGELTAWDSLHEFGNKLAGTKVSKGDPIFPRLDLAEEASWIVGMMSGG
SVAAAPAVEAGADTAAEAGVAGNADDNAAGNDKALEPTPDLAPEISIDDFMKVELRVAQV
IACEPIPKADKLLKLQLDLGFEVRQVVSGIAKFYKPEELIGRKVICVTNLKPVKLRGEMS
KGMILAASQGDQLTLATVPEGMPNGALVK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagcgaacaaatcattttacattacgacaccgatttattacccaagtgacaag
ctacatatcggtcatgcttatacgactgttgctggggatgcgatggctcgttacaagcgt
ctgcgcgggtacaatgtgcgctatttaacgggaacggatgagcatggacagaagatcgag
cgcaaagctgaggaagcaggcaaaacaccgcagcaattcgtggacgatatcgttgtaggt
attaaagaattgtggagcaagctggaaattactaatgatgacttcattcgcacaacagag
cctcgccacacgaaggttgtccaaggcatttttacgaagctgttagagcaaggggatatt
tacaaaggtgagtacgaaggctggtacagcatatcggatgaaaccttctacacggaaaca
cagctgacagatattgtgcgcaacgagaacggtgacgttattggggggaaaagtcctgat
agcgggcatccggtagagcttgtcaaagaagagtcctatttcttccgaatgagtaaatat
gcagacagattgcttgcttactatgaagagaaccctgatttcattcagccagaatcacgc
aagacggaaatgatcaacaattttattaagccaggccttgaagatctggctgtttcccgc
acaacctttagttggggggttcctgttccgggtgatcctaagcatgttatttacgtatgg
atcgatgcgctttctaactatataacggcactcggatatggcacagactcggatgagctt
ttccgtcagtactggccggccagcgtgcatctgatgagcaaagagattgtgcggttccat
acgatctattggccgattatgatgatggcgcttgatcttccagtgccagagaaggtattc
gcacatggatggcttctgatgaaggacggcaagatgtccaaatctaaaggcaatgttgtt
gatccggttaagcttatcgagcatttcggattggatgctgttcgttattacttgcttcgt
gaagtgccgtttggtgcggatggtgcattcaccccggaaggcttcgtagaacggattaac
tacgatcttgctaatgatcttggtaatctactcaatcgtacgattgcaatgattgacaag
tactttgatggtgttcttccgaatttcgagttggggattacagagtttgatggagagctc
gagcaaacggcactctcaactattgagaaggtagaagagtcacttgagaaaatggagttt
tctgttgcgctcagcgcgatatggacgctcgttggccgcacaaacaagtatattgacgag
acgaagccttggacgcttgctaaggaagagtctagcaaaccagctttggcttccgtaatg
gggcatttggcagaaagcttgaggatcgtctctattctgattcaacctttcctaacccac
actccgggtcttatctggacacagctggggcttgaaaagggtgagttaacggcatgggat
agcttacatgaattcggaaataaacttgctggaacgaaggttagcaagggtgatccgata
ttccctcgtttggacttggcggaagaggcgtcttggatcgttggtatgatgtccggtgga
tcagtagctgcggcaccagccgttgaagctggcgcggatacagcggctgaggctggagtg
gcagggaatgcggatgacaatgcagcgggcaatgataaagccttggagcctacgcctgat
ctagcaccggaaattagtatcgacgatttcatgaaggtggagctgcgtgtagcacaggtt
attgcctgtgaaccgattcctaaggccgacaagctgcttaagctgcagctcgatcttggc
tttgaagtgagacaggtcgtatcaggcattgctaagttttataagccagaagagttgatc
ggtcgcaaggtgatttgcgtcacgaatcttaagccggtaaagctgcgtggagaaatgtcc
aaaggtatgatactcgccgcatcgcaaggggatcaattaactttagcaactgttccagaa
ggtatgcctaatggcgcattggtgaaataa

DBGET integrated database retrieval system