KEGG   Cohnella sp. HS21: KCTCHS21_54260Help
Entry
KCTCHS21_54260    CDS       T05979                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cohn  Cohnella sp. HS21
Pathway
cohn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cohn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    KCTCHS21_54260 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cohn03011]
    KCTCHS21_54260 (rplV)
Ribosome [BR:cohn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    KCTCHS21_54260 (rplV)
  Bacteria
    KCTCHS21_54260 (rplV)
  Archaea
    KCTCHS21_54260 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BBI36027
UniProt: A0A3T1DD54
Position
complement(6129756..6130094)
Genome map
AA seq 112 aa AA seqDB search
MSQQAKAHVNNIRIPARKVRLVVDLIRGKKVGDAVAILRHTPRSASPVLEKLLNSAIANA
EHNYQLDVNKLFISEAFVNEGPTMKRFQPRSQGRAFSIFKRSSHITLVVSEK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagcaagccaaagctcatgtgaataacattcgcataccggctcgtaaagtccgc
ctggtcgttgacctgattcgcggtaaaaaagtcggcgatgctgttgctatcttgcgtcat
acgccgcgttcggcatctccggttttggagaagctattgaactctgctatcgcaaacgct
gaacacaactaccagcttgacgtgaacaaattgttcatatccgaagccttcgttaatgaa
ggtccaacgatgaaacgattccaaccacgttcacagggccgtgcgttcagcatcttcaaa
cgatccagccatattacactggtcgtatccgaaaaataa

DBGET integrated database retrieval system