KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_0357Help
Entry
CpCIP5297_0357    CDS       T02054                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
coi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:coi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CpCIP5297_0357 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:coi03011]
    CpCIP5297_0357 (rplV)
Ribosome [BR:coi03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CpCIP5297_0357 (rplV)
  Bacteria
    CpCIP5297_0357 (rplV)
  Archaea
    CpCIP5297_0357 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AEQ05912
Position
379627..379989
Genome map
AA seq 120 aa AA seqDB search
MSESVTSARATARFVRVSPMKARRVIDLVRGKSIEEALAILKYAPQAASEPVAKVVASAA
ANAENNFGLDRRSLVISEAFADEGPTMRRFSPRAQGRAFQIRKRTSHITVVVESQKEGAK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatctgtcacctccgcacgcgctaccgcgcgcttcgtccgtgtttctcctatg
aaggcacgtcgtgtgatcgatctggtccgcggcaagtccatcgaggaagcactcgcaatc
ctgaagtacgctccacaggctgcttctgagccggttgcaaaggtcgttgcttctgcagcc
gctaacgctgagaacaacttcggtctagatcgtcgctccctggtcatctctgaggctttt
gccgacgagggtccgaccatgcgtcgtttcagcccccgcgctcagggtcgtgctttccag
atccgcaagcgcaccagccacatcaccgtggttgttgagagccagaaggaaggggccaag
tag

DBGET integrated database retrieval system