KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_0679Help
Entry
CpCIP5297_0679    CDS       T02054                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
coi00040  Pentose and glucuronate interconversions
coi00052  Galactose metabolism
coi00500  Starch and sucrose metabolism
coi00520  Amino sugar and nucleotide sugar metabolism
coi01100  Metabolic pathways
coi01130  Biosynthesis of antibiotics
Module
coi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CpCIP5297_0679 (galU)
   00052 Galactose metabolism
    CpCIP5297_0679 (galU)
   00500 Starch and sucrose metabolism
    CpCIP5297_0679 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CpCIP5297_0679 (galU)
Enzymes [BR:coi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CpCIP5297_0679 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEQ06225
Position
728106..729035
Genome map
AA seq 309 aa AA seqDB search
MKQPQEAQDSTRVAVKTVIVPAAGMGTRFLPATKTVPKELLPVVDTPGIELIAEEAAQLG
ATRLAVITAPNKQEVMEHFKRFPVLEETLQSRGKTEQYEKVVHASELIAPVSVVQEKPLG
LGHAVGMAESVLDPDEDAVAVMLPDDLVLPRGVVEKMVEVREQLGGSVLCAFEVPEEEVY
NYGVFEIDESAYDGPHHVKKVKGMVEKPSVEEAPSNFVATGRYLLDRAIFDALRRITPGA
GGELQLTDAIDLLIDEGHPVHILVHDGKRHDLGNPGGYIPAVVDFGLRDPAYGPHLKKVL
RKILEEHGA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcctcaagaagctcaagacagtacgcgcgtcgcggtgaagactgtcatcgtt
cctgctgctggcatgggaacgagattccttcctgccacaaaaacggttcctaaagaacta
ttgccagtggtagataccccaggcattgaactgattgcagaagaagcagctcagttgggg
gcaactcgactcgcagtaattacggctcctaataagcaggaagtcatggagcactttaag
cgattcccagtgttggaagagaccctacaaagccggggcaaaaccgaacaatatgaaaaa
gttgttcatgcctctgagcttattgcgccagtttccgtagtgcaggaaaagccgctcggc
cttgggcatgctgttggcatggcggaatcagtccttgatcctgatgaggacgctgtagca
gtcatgcttcccgatgatctagtgcttccgcggggcgtcgtggagaagatggtcgaggta
cgcgagcaactaggcggatctgtgttgtgcgcctttgaagtgccggaggaagaagtctat
aactacggtgtctttgagatcgatgagagtgcatatgatggccctcatcacgtcaaaaaa
gtcaaaggaatggtagaaaaaccctctgtagaagaggctccttcaaattttgtggctacc
ggccgctatttgctcgaccgggctatttttgatgcactccgtagaattaccccgggtgct
ggcggtgagctgcaactcacggatgccattgatttgcttatcgacgaaggccaccctgtg
catattcttgtgcatgacgggaagcgtcatgatcttggcaaccccgggggatacataccg
gctgttgttgattttgggttgcgcgatccagcgtatgggccgcacttaaagaaggtcctc
cgaaagattttggaagaacacggcgcataa

DBGET integrated database retrieval system