KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_1372Help
Entry
CpCIP5297_1372    CDS       T02054                                 

Gene name
trpC2
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
coi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
coi01100  Metabolic pathways
coi01110  Biosynthesis of secondary metabolites
coi01130  Biosynthesis of antibiotics
coi01230  Biosynthesis of amino acids
Module
coi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CpCIP5297_1372 (trpC2)
Enzymes [BR:coi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CpCIP5297_1372 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEQ06902
Position
complement(1508785..1509594)
Genome map
AA seq 269 aa AA seqDB search
MPSVFEEIIAGVIEDVAARESVVSFKEIKARSRACEPPRDAIAALLNSGCGVIAEIKRAA
PDKGVLAEINSPVGLAKELVAGGASLIACQTEWRRFHGSLSEMAEIRNVISVPIMCRDFI
VDPYQIHEARCYGADMVPLRVAALDQARMIALIDRIESLGMAALVEVRDTEEASRAVAAG
AKIIGVNARDFSTMTLNRLAFAEIAPGLPTDVIRVALSGVRNARELLDYAASGADAVVVG
EKIVTAADPCEATRSLVAAGQHPSCPSRG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagtcttcgaagagattattgcgggcgtcattgaagatgtagctgcgcgagaa
tcagtggtgtcgtttaaagagatcaaagcccgttcgcgtgcttgcgagccgcctcgggat
gcaatagcggcgcttcttaatagtggttgtggtgtgatcgctgagattaaacgtgctgct
ccagataaaggcgttttagcagagatcaattctcctgttggcttagcaaaagaacttgtc
gccgggggcgctagtttgattgcgtgtcagacggaatggcgaaggttccacggttcatta
tctgagatggctgagattcgtaatgtgatatcggtgccaataatgtgccgagactttatc
gtggatccctatcaaattcatgaggcacgctgttatggagcggacatggtgcccttgcgc
gtagctgctttagaccaagccaggatgattgcgcttatagatagaatcgagtccctgggg
atggcagcgctggtagaagtccgggatactgaggaagcatcgcgtgcggtggcagcgggt
gcgaagatcataggggtaaacgcccgggatttctcaacgatgacgctcaaccgcctggcc
ttcgcagaaattgctcctggacttcctacagatgttattagagttgcattgtccggtgtg
cgcaatgctcgtgaactcctggattacgctgcctctggtgcggacgcggtggttgtggga
gaaaaaattgttactgctgcggatccgtgcgaagcgacgcgttcgttggtggcagcaggc
caacatccatcgtgtccatcgcgaggataa

DBGET integrated database retrieval system