KEGG   Corynebacterium pseudotuberculosis CIP 52.97: CpCIP5297_2115Help
Entry
CpCIP5297_2115    CDS       T02054                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
coi  Corynebacterium pseudotuberculosis CIP 52.97
Pathway
coi00260  Glycine, serine and threonine metabolism
coi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
coi01100  Metabolic pathways
coi01110  Biosynthesis of secondary metabolites
coi01130  Biosynthesis of antibiotics
coi01230  Biosynthesis of amino acids
Module
coi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:coi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CpCIP5297_2115 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CpCIP5297_2115 (trpB)
Enzymes [BR:coi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CpCIP5297_2115 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEQ07605
Position
2343532..2344782
Genome map
AA seq 416 aa AA seqDB search
MTLSYNETTQQTLLPAYFGEFGGQFVPESLLPALDQLEKAFVEAQEDPHFRKELASYLKD
YLGRPTPLTECSKLPLQGKGKGYARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKKRII
AETGAGQHGTATALACTLLNLECVIYMGAKDVERQQPNVYRMELMGATVVSVDSGSGTLK
DAVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQMLERTGGLPDVV
VACVGGGSNAIGMFADFIEDASVELVGAEPGGEGLSSGKHGATINNGRIGILHGAKSYLM
RNSDGQVEESYSISAGLDYPGVGPQHAHLSQSGRATYVAITDAEALEAFQLLSREEGIIP
ALESSHALAYALKRAALAEEEGKNITILVSLSGRGDKDIDHIRKTLAANPELSLKD
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacactttcttacaacgaaaccactcagcaaacactccttcctgcatactttggggag
ttcggcggacagtttgtccccgagtcacttcttccagcgcttgatcagcttgaaaaagct
tttgtcgaggcccaagaagacccacactttcgcaaagaactagcgagctatctcaaagac
tatttgggaagaccaactccattaacggaatgctccaagctacctttacagggaaaaggt
aagggatatgcgcgcatcttccttaaacgcgaagaccttgttcacggtggagcacataaa
acaaaccaagttatcggccaggctcttttagctaagaggatgggtaaaaagcgcatcatc
gcagaaactggtgccgggcaacatgggacagcaaccgcccttgcatgcacacttttaaac
ctcgaatgcgtcatttacatgggggctaaagacgtggaacgtcaacagcccaatgtgtat
cgcatggagcttatgggagctactgtagtgtccgtagattcaggttccgggacactcaaa
gatgccgtcaatgaggccctgcgcgattggaccgcaacgttccacgaatcccattatctg
ctcggtacagcagccggacctcatccgtttcccacgatcgtccgagaatttcatcgtgtc
atttcagaggaagctaaagcacaaatgcttgagcgcaccggcggactcccggatgttgtg
gttgcttgcgtgggcggaggctccaacgcaataggtatgtttgcagacttcattgaggat
gcatctgtagaactcgttggtgcggaacccggcggtgagggattatcgtccggaaagcac
ggtgcaaccattaacaatggacgtatcggtatcctgcacggcgccaaaagctatttgatg
cgaaattctgatggtcaagtggaagaatcctattccatttccgccgggctggattatccc
ggagtcggtccacagcacgcgcacctatcgcagtctgggcgagccacctatgtggccatc
acagatgccgaggcgcttgaagccttccaattactttcccgtgaagagggaatcattcca
gcattagagtccagccacgccctcgcatatgcgttgaaaagagctgccctcgcggaggaa
gagggtaagaatatcaccatattggtctccctttcagggcgtggcgataaagacatcgat
cacattcgcaagactctagctgccaaccccgagctttccctcaaggactaa

DBGET integrated database retrieval system