KEGG   Capnocytophaga sp. oral taxon 323: AM608_02850Help
Entry
AM608_02850       CDS       T04076                                 

Definition
(GenBank) N-acetylneuraminate lyase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
col  Capnocytophaga sp. oral taxon 323
Pathway
col00520  Amino sugar and nucleotide sugar metabolism
col01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:col00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AM608_02850
Enzymes [BR:col01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     AM608_02850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: ALC96661
UniProt: A0A0M4G7F7
Position
complement(648521..649444)
Genome map
AA seq 307 aa AA seqDB search
MTFEKINGLIVAPFTPFDKKGEVNLDPIDKYAKLLQKNGLIGVFINGSSGEGYMMTVEER
MKIAEKWVSVAPKGFKVIVHCGATCIKDSYKMAQHAQEIRAFGIGAMASPFPKAGRVEEL
VKYCEEIACGAPNLPFYFYHIPVLNGVYLPMLPFLKAADGRIPNLAGIKYTYEPLYEYNQ
CMLYNNGKYDMLYGLDETILNALVMGGARGGISGTGSYIGKVLVGIIDEYHKGNIAKAAE
LQNYAQDVINVIAKYRGNIVCGKRIMKLLGLDLGINRTPFQNITDEEEAVIKKELESIDF
FNKCNQM
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacatttgaaaaaattaatgggctgatagtagcgccctttacaccttttgacaagaaa
ggagaagtaaatttagaccctattgataaatatgcaaaactcttgcaaaaaaatggattg
ataggcgtatttatcaacggttcgtcaggtgaaggctatatgatgacggttgaagaacgt
atgaagatagccgaaaaatgggtatcagtagctcccaaaggcttcaaagtgattgtacac
tgtggggctacctgcataaaagatagctacaaaatggcacaacacgcccaagaaattaga
gctttcggtattggggcaatggcttcacctttccccaaagcgggtagggtagaggagctg
gtgaaatactgcgaggaaatagcttgtggagcgcctaatctgcctttctatttttaccat
atccctgtgctcaatggggtgtaccttcctatgttgcctttccttaaagcagctgacgga
cgtattcctaacttagcgggtatcaaatacacctacgaaccactttatgagtacaaccaa
tgtatgttgtacaacaatggtaaatacgatatgctctacggcttagacgagactatcctc
aatgctcttgtaatggggggtgctcgtggtggtattagcggtactggtagctatataggc
aaggtattggtaggtatcatagatgaataccacaaaggcaatattgccaaagctgctgag
ttgcaaaactacgcccaagacgtgataaatgtaattgctaaatatcgtggcaacatagtg
tgcggtaagcgtataatgaagttgctcggtttagacttaggtatcaatcgtacgcctttc
caaaacattactgatgaagaggaagcagtcattaagaaagaattggaaagcattgatttc
tttaacaaatgtaaccaaatgtag

DBGET integrated database retrieval system