KEGG   Capnocytophaga sp. oral taxon 323: AM608_10320Help
Entry
AM608_10320       CDS       T04076                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
col  Capnocytophaga sp. oral taxon 323
Pathway
col00471  D-Glutamine and D-glutamate metabolism
col00550  Peptidoglycan biosynthesis
col01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:col00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AM608_10320
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AM608_10320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:col01011]
    AM608_10320
Enzymes [BR:col01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     AM608_10320
Peptidoglycan biosynthesis and degradation proteins [BR:col01011]
 Precursor biosynthesis
  Amino acid ligase
   AM608_10320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ALC97999
UniProt: A0A0M4G9U5
Position
complement(2355601..2356935)
Genome map
AA seq 444 aa AA seqDB search
MKRLVILGGGESGVGTAILGKQKGWEVFLSDKGSLKPHYRETLNKEGIQWEEGTHTEEKI
LSADVIMKSPGIPDKAPIIKKAHEKGIAVISEIEFASQYTDSLIVGITGSNGKTTTTLLT
YHIFKEAGLQVGLGGNIGYSFAELVATENPPYYVLEISSFQLDGIEHFAPHIAVLLNITP
DHLDRYDYKFENYINSKFRIAMNQTENDYLIYDADDEVITQWLSTHTIKSKLIPFSIEKE
LPQGAFLKDNKIYIMLENQTTEIDVEEISLRGKHNIKNTMAASVAARLVNIRNNSLRESL
KGFKGAPHRLEEVKVVDGVTYVNDSKATNVNSVFYALDTIKTPIVWIVGGQDKGNDYNSL
LPYVHEKVRAIVCLGVDNSPIIQSFHNTIGTLVETRSMDEAVKLAQGFAQEGDTVLLSPA
CASFDLFKNYEERGDLFKVAVQKL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtttagtaatattaggaggtggtgaaagtggtgtaggaactgctattctcggt
aaacaaaaaggctgggaagtattcctttccgataaaggctccctaaaacctcactaccgc
gaaactcttaacaaagaaggcattcagtgggaagaaggcacacacaccgaagagaaaatt
ctctcagccgatgtgattatgaaaagcccaggtatccccgataaagctcctatcatcaaa
aaagctcacgaaaaaggcattgctgtgatttctgaaatagaatttgcaagccaatatacc
gatagcctcattgtaggcatcacaggtagtaatggtaaaaccactaccaccttgctcact
tatcacattttcaaagaagcgggattgcaagtgggacttggcggaaacataggttatagc
ttcgccgaattagtagctaccgaaaatccaccgtattatgtactcgaaatcagtagtttt
cagttagacggcatagagcattttgccccccatatcgccgtattgcttaacataactcct
gaccatctggataggtacgactataagttcgaaaactatatcaactctaaattccgtatc
gcgatgaaccaaactgaaaatgattaccttatctatgatgccgacgacgaggtaattaca
cagtggctcagcacccatactataaaatctaaactcatacctttttctatagagaaagaa
ctcccacaaggagctttcttaaaagataataaaatatacattatgttagagaatcaaact
actgaaatcgacgttgaagaaattagccttcgtggcaagcacaacattaaaaatacaatg
gcagcaagtgtagctgcccgcttggtaaatatccgcaacaattcattgcgcgaaagtctc
aaaggctttaaaggtgctccccaccgtctcgaagaggtgaaagtagtagatggcgtcact
tacgtaaacgactccaaagctactaacgtaaattcagtattctacgctctcgacaccatt
aaaactcctatcgtgtggatagttggcggacaagacaaaggcaacgactataactctctt
ttgccttatgtacacgaaaaagtaagagctattgtatgtctcggagtcgataattcccct
attattcaatcgtttcacaacacaataggcacgcttgtcgaaacccgctcaatggacgaa
gctgtaaaattagcacaaggttttgctcaagaaggcgatacagtactattatctcccgct
tgcgccagcttcgacctctttaaaaactacgaagaacgcggagacctctttaaagtagcc
gttcagaaactgtaa

DBGET integrated database retrieval system