KEGG   Colwellia sp. Arc7-D: DBO93_05410Help
Entry
DBO93_05410       CDS       T05422                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system aminomethyltransferase GcvT
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
cola  Colwellia sp. Arc7-D
Pathway
cola00260  Glycine, serine and threonine metabolism
cola00630  Glyoxylate and dicarboxylate metabolism
cola00670  One carbon pool by folate
cola01100  Metabolic pathways
cola01110  Biosynthesis of secondary metabolites
cola01130  Biosynthesis of antibiotics
cola01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DBO93_05410 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DBO93_05410 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    DBO93_05410 (gcvT)
Enzymes [BR:cola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     DBO93_05410 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: AWB57046
UniProt: A0A2S0UYL1
Position
1226585..1227673
Genome map
AA seq 362 aa AA seqDB search
MSNKTVLHAKHLEAGAKMVDFYGWEMPINYGSQIEEHHAVRNDAGMFDVSHMTIVDVKGA
DAQAFLRRLVINDVAKLDVAGKALYTGMCNEEGGVIDDLIVYFFSNTDYRLVVNSATRVK
DLAWINEQANAFDVTITERPEFAMIAVQGPQAKAKVATLLTSEQTAAVDGMKPFFSAQAG
DLFIATTGYTGENGYEIALPAEQAADLWQQLLDAGVKPCGLGARDTLRLEAGMNLYGLDM
DESVSPLAANMAWTISWEPEDRNFNGREALASQRAAGDQPKLVGLVLEEKGVLRTGLKVL
TESGEGIITSGTFSPTLGHSIAMARVPRSVALGSTVEVEMRKKLVKVQVIKPSFVRNGKK
VF
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataaaacagtattacatgctaagcatttagaagctggcgccaaaatggttgat
ttttacggttgggaaatgccaattaactatggctctcaaattgaagagcatcacgccgtg
cgcaatgacgctggtatgttcgacgtttcacacatgaccattgttgatgttaaaggcgca
gatgcacaagcatttttacgtcgtttagtgattaacgacgtagccaagttagacgttgca
ggtaaagcgctttataccggtatgtgtaatgaagaaggcggtgtaatcgatgacttaatc
gtttacttcttctcaaatactgattatcgcttagtggttaactcagcaactcgcgtaaaa
gatttagcgtggataaacgagcaagctaatgcatttgacgtaacgattacagaacgtcca
gaatttgccatgatcgctgtgcaaggtccacaagctaaagctaaagttgctacgttactt
acttcagagcaaaccgcagccgttgatggtatgaagccatttttctcagctcaagctggc
gacttatttattgctactacgggttacacaggtgaaaacggttacgaaatcgctttacct
gctgagcaagctgcagacctttggcaacaattgctagacgctggtgttaaaccttgtggt
ttaggtgcacgcgatactttacgtttagaagcaggcatgaacctttatggtttagatatg
gacgagagcgtttcgccattagccgctaacatggcgtggacgattagttgggaaccagaa
gatcgtaactttaacggtcgtgaagcattagcctcacaacgtgccgcaggtgaccaacct
aaattagtaggtttagtgctagaagaaaaaggcgtacttcgtactggccttaaagtgcta
actgaatctggcgaaggtattattacttcaggtacattctcaccaacgttaggccacagt
attgcgatggcgcgtgtaccacgtagcgtagcgctaggcagcacagtagaagttgaaatg
cgtaaaaaactagtgaaagtacaagttattaagcctagctttgtgcgtaacggcaaaaaa
gttttttaa

DBGET integrated database retrieval system