KEGG   Colwellia sp. Arc7-D: DBO93_13940Help
Entry
DBO93_13940       CDS       T05422                                 

Definition
(GenBank) 5'/3'-nucleotidase SurE
  KO
K03787  5'-nucleotidase [EC:3.1.3.5]
Organism
cola  Colwellia sp. Arc7-D
Pathway
cola00230  Purine metabolism
cola00240  Pyrimidine metabolism
cola00760  Nicotinate and nicotinamide metabolism
cola01100  Metabolic pathways
cola01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cola00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DBO93_13940
   00240 Pyrimidine metabolism
    DBO93_13940
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DBO93_13940
Enzymes [BR:cola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     DBO93_13940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurE
Motif
Other DBs
NCBI-ProteinID: AWB58548
UniProt: A0A2S0V2Y2
Position
complement(3225887..3226639)
Genome map
AA seq 250 aa AA seqDB search
MRILLSNDDGVHADGIKVLFDELAKFFDVTVVAPDRNCSGASNSLTLLNPLRAHTLENGF
ISVNGTPTDAVHLGAAQLMKPQPDLVVAGINHGANLGDDTIYSGTVAAATEGRHLGMPAI
AVSLVSSEPKHFQTAAVVTAKFIERLKLHPLPSDQIININVPDVPLEQLKGIQVTRLGNR
HKAETMKKVKDPWQRDIYWYGPLGQELDAGVGTDFHAIANGYASITPLTIDMTAYKSLAK
MTEWINELSI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaatattactgagtaatgacgacggtgttcatgcagatggcattaaagtcctcttt
gatgaattagcaaaattttttgatgtcaccgtagttgcacctgatagaaattgtagtggt
gcaagtaactccttaacattgctgaacccattacgtgctcatactttagaaaatggcttt
atttcggttaatggtacacctactgatgctgttcacttaggcgcagcacaattaatgaag
ccacaacctgacttagttgtagcgggtattaatcatggtgctaatttaggtgatgacact
atatattctggtacggtagcagccgcaacagaagggcgtcacttaggtatgccagcgata
gcggtttcattagtctcttcagagcctaagcactttcaaacagcggcggttgttacggcc
aaatttattgagcgtttaaagctgcatccgctgcctagcgatcaaattattaatattaat
gtacctgatgtgccacttgaacaactcaaaggcattcaagtaacacgcttaggtaaccgc
cataaagcggaaacaatgaaaaaggtgaaagatccttggcaacgtgatatttattggtac
ggtccattaggacaagagcttgacgctggtgtaggcactgattttcatgcgatagccaat
ggctatgcttcgattactcccttaacgatcgatatgaccgcttataagagcttggcaaaa
atgacagaatggattaatgaactttcaatatga

DBGET integrated database retrieval system