KEGG   Colwellia sp. PAMC 21821: A3Q33_02905Help
Entry
A3Q33_02905       CDS       T04816                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
colw  Colwellia sp. PAMC 21821
Pathway
colw00360  Phenylalanine metabolism
colw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
colw00790  Folate biosynthesis
colw01100  Metabolic pathways
colw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:colw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    A3Q33_02905 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A3Q33_02905 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A3Q33_02905 (phhA)
Enzymes [BR:colw01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     A3Q33_02905 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ARD43354
UniProt: A0A1V0KNM0
Position
complement(691120..691920)
Genome map
AA seq 266 aa AA seqDB search
MAKATKYVSKVADEHGNIAWTAEENQIWQALITRQLSTVKDTACDEFNEGLEKLNLPIDR
IPQLEEVSQVLRATTGWSCEPVPALIGFGEFFRLLSEKKFPVATFIRSQEEFDYLQEPDI
FHEIYGHCALLTNESFANYTQAYGMMGLNASKEDRVFLARLYWFTVEFGLLDTPKGLRVY
GGGILSSPTETEYALHDKNVERKPLDVLDVLRTQYRIDILQPVYFMLTKVSDLDEIRKLE
VEDIMALVEQAKKIGLHPAKFELKAS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcgactaagtacgtatcgaaggttgctgatgaacatggcaatattgcatgg
acagcagaagaaaaccaaatttggcaagccttgataacgcggcaactttcaaccgtaaaa
gatactgcctgtgatgagttcaatgaaggtttagaaaagctaaatctacccattgatcgt
ataccacagttagaggaagtgagtcaggtattaagagcgactaccggttggagttgtgaa
cctgttccagcacttatcggttttggtgagtttttcagattactgtcagaaaagaaattt
cctgttgcgacttttatccgctcgcaagaagaattcgactatctacaagagcccgatatc
tttcatgaaatatacggccactgtgcattacttaccaacgaatcttttgctaattatacg
caagcttatggcatgatgggtttaaacgcttcgaaagaagaccgggtatttttagcccga
ctttattggtttactgttgagtttggcttgcttgatacgcccaaaggtttacgggtatat
ggtggtggtattttgtcttcaccaacggaaacagaatatgcattacatgataaaaatgtt
gaaaggaaacctctcgatgttttagatgtgttacggacacaatatcgaattgatattctg
caaccggtttattttatgctgactaaagtcagtgatctcgatgagatacgaaaattagaa
gtagaagatattatggccttggtagaacaagcgaaaaaaataggtctacatccagctaaa
tttgaattaaaagcaagttaa

DBGET integrated database retrieval system