KEGG   Colwellia sp. PAMC 21821: A3Q33_12510Help
Entry
A3Q33_12510       CDS       T04816                                 

Definition
(GenBank) inorganic phosphate transporter PiT family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
colw  Colwellia sp. PAMC 21821
Brite
KEGG Orthology (KO) [BR:colw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A3Q33_12510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ARD45058
UniProt: A0A1V0KTF6
Position
2951571..2952866
Genome map
AA seq 431 aa AA seqDB search
MEILLSHGSTLVMIAAVVGFFMAWGIGANDVANAMGTSVGSKALTIKQAIIIAMIFEFAG
AYLAGGEVTSTIRKGIIDPALFVDIPELLVFGMISALLAAATWLLVASVLGWPVSTTHSI
VGAIIGFAAIGISPDTVAWGKVGGIVGSWVITPLISGVIAFIIFNSAQKLIFDTEKPLEQ
AKRYVPFYMFLAGFVLSLVTIKKGLKHIGLENIDVGFYNFEIAGAGGYYLAIIVAIVVAI
VGKYFVSRLKFDDKADKTTHYANVEKVFAVLMVVTACCMAFAHGSNDVANAIGPLAAVVS
IVDNGGEIAKKASLVWWILPLGGFGIVAGLALFGHRVIATIGKGITHLTPSRGFAAELAA
ACTVVIASGAGLPISTTQTLVGAVLGVGMARGIAAINLGVVRNIVISWVITLPIGAGLSI
IFFWIMKAIFS
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggaaattttactctctcatggctctacgttagtcatgatcgccgctgtcgtcggtttt
tttatggcatggggcataggtgccaacgatgttgctaatgcaatgggtacatcggttggt
tcaaaagcgttaacaattaagcaagctattatcattgcaatgatttttgaatttgcaggc
gcatatttagcgggtggtgaagttacatcaaccatacgtaagggcattattgaccccgcg
ttgtttgtcgatatacctgaactcttagtcttcggtatgatttcagcgctattagctgca
gcaacttggttgttagtggcgtctgtattaggctggccagtatcaactactcactctatt
gttggtgctataattggctttgctgcaatcggcataagcccagatacagtagcttggggc
aaagtaggtggtattgttggtagttgggttatcacgccgttaatttctggtgttattgct
tttattatatttaatagcgcacaaaaacttatttttgatactgaaaaaccattagaacaa
gcgaaacgatacgtaccgttttacatgtttttagctggttttgtcttgtcattagtgaca
attaaaaaaggtttaaagcacattggtttagagaatatcgatgtcggtttttataacttt
gaaattgctggtgctggtggttattatcttgccattattgttgcaatcgttgtggctatt
gttggtaagtactttgtttcacgacttaagtttgacgataaagctgataaaactacacat
tacgcaaacgtagaaaaagtgtttgctgttttaatggttgtaacggcttgttgtatggca
tttgctcacggttcaaatgatgtagccaacgctattgggccgttagccgcagtcgtcagt
attgttgataacggtggtgaaatagcgaaaaaagctagccttgtatggtggatattacca
ctaggtggttttggtattgttgcaggtcttgcattgtttggtcatcgtgttattgccaca
attggtaaaggtattacacacttaacacccagtcgtggttttgccgctgagttagctgcg
gcatgtaccgttgttattgcttcaggtgctggcttaccaatctcaactacacaaacctta
gtaggtgctgtgctaggtgtgggaatggcgcgtggtattgccgcaatcaacttaggtgtt
gtacgtaatattgttatctcttgggtgattacattaccaataggtgcaggtctttcaatt
atcttcttctggataatgaaagcgatatttagttaa

DBGET integrated database retrieval system