KEGG   Colwellia sp. PAMC 21821: A3Q33_16870Help
Entry
A3Q33_16870       CDS       T04816                                 

Gene name
putA
Definition
(GenBank) trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
colw  Colwellia sp. PAMC 21821
Pathway
colw00250  Alanine, aspartate and glutamate metabolism
colw00330  Arginine and proline metabolism
colw01100  Metabolic pathways
colw01110  Biosynthesis of secondary metabolites
colw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:colw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A3Q33_16870 (putA)
   00330 Arginine and proline metabolism
    A3Q33_16870 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:colw03000]
    A3Q33_16870 (putA)
Enzymes [BR:colw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     A3Q33_16870 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     A3Q33_16870 (putA)
Transcription factors [BR:colw03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    A3Q33_16870 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: ARD45811
UniProt: A0A1V0KVW4
Position
4001856..4005692
Genome map
AA seq 1278 aa AA seqDB search
MLFNGSFVSDCPTRQKIREFYRIDENTAVDHILPLAEVNVSARSRAWERARKMVLKIRND
QSGNGAIDALLNEYSLSSEEGVVLMCLAEALLRVPDKHTQDVLIRDKISQGQWSTHLGSS
ESLFVNASSWGLLITGAMVNYADKRKQDSFGLLKKTIGRLGEPVIRKSMNYAMKIMGKQF
VMGETIVAATERAADKEQKGYVYSYDMLGEGARTMDDANRYLKAYQDAIETIGKVARASG
KNDPRRVPGISVKLSAIHPRYEFTHQARVMAEIVPKLKALCLQAKSYNIGLTVDAEESER
LDISLDIIEAVFSDGDLAGWDGFGIALQAYQKRAIFVVDWLRELTLRVNRKMMVRLVKGA
YWDTEIKNAQKDGLQHFPVFTRKSSTDVSYHACANKLLEYRDSIYPQFATHNAYTAATIV
ELAGDDKEGFEFQCLHGMGDSLYDQIVSLESIQCRIYAPVGHHEDLLAYLVRRLLENGAN
SSFVNAIVDESQPVESLLEDPVEKTQRLKDKYNQQIIKPIALYHDKKGLGRDNSKGLDLT
DINVITPLKVSLDNWFEANEIKSNDLPAGAVAVMNPANHKEIIGFHHHHSKDDMLAMIET
AQTAFTSWSQTPVAERAALLCRVADILERHTDELIALCIKEAGKIAQDGIDEVREAVDFC
RYYAEQALEIAADERVEARGVVLCISPWNFPLAIFLGQVAAAIATGNTVLAKPAEQTSLI
ALRTIELMKYVGLPEGVVQAVIARGSEVGSVIIPDARIQTVMFTGSTETGTIISQTLADR
GGDQVPLIAETGGQNCMIVDSTALPEQVVDDVISSGFQSAGQRCSALRVLFLQEDIADDV
ITMLKGALAELHVGNPEYLSTDIGPVIDQKALSALNAHSDYMKDHGKLLYQCPIGDEITN
NIAANEHFFFAPRLYEIDDISVLKKEVFGPCVHVVRFKGNDIESVVDKINGTGFGLTMGI
HTRIEHRAFELAKLSRAGNVYINRNMIGAIVGVQPFGGRGLSGTGPKAGGPNYLSRLVIE
KATPDAEQFNLLPSQVEALDGDAKSDAESVLFMDKANAAEKAWRLTELNNRISCVRQLLA
KIAHVDIVEDLADDLNRTLKSARAQLINIEKRMKKPTFLPGPTGESNILYLENRGNIICF
ADKNVSFHFWVLSIVTALATGNTVISVVSDLYYDEAIAFRDKFLSTGADAGVFQVARLRH
LSTMLSHPALAGVVVDSNCDRKHYISEKLAERQGAILPVISSEYFDNLIQRLLTEKTVSI
DTTASGGNTSLMTLVEED
NT seq 3837 nt NT seq  +upstreamnt  +downstreamnt
atgctttttaatggttcgtttgtctcagattgcccaactcgtcaaaaaattcgtgaattc
taccgtattgatgagaatacagcggtagatcatattttaccccttgctgaagtgaacgtc
agcgcccgaagtcgtgcttgggaaagagcgcgtaaaatggtgttaaaaattcgcaatgac
cagtcaggtaacggtgcgatagacgccttgctaaacgaatattcactctcaagtgaagaa
ggcgtggtcttgatgtgcttggccgaagctttgctgcgtgtgccagacaagcatacccaa
gatgtacttattcgtgacaaaatttctcaaggtcagtggagcacgcatttaggcagcagc
gaatcactgtttgttaatgcttcatcgtggggcttgttaattaccggcgctatggtgaat
tatgccgataaacgcaaacaagacagctttggtttattgaaaaaaactatcggtcgttta
ggcgagccggttattcgtaaatctatgaactatgccatgaaaattatgggcaagcagttc
gtgatgggcgaaaccattgtagcggcaacagaacgtgcagcggataaagagcaaaagggt
tatgtttactcttatgacatgctcggtgaaggcgcgcgcaccatggacgacgctaaccgt
tatttaaaagcgtatcaagatgcaatagagaccattggtaaagtcgcacgggcttcaggt
aaaaacgacccacgccgcgtgccgggtatttcggtgaagctttctgctattcacccgcgt
tatgagtttactcaccaagcacgcgtgatggctgaaattgtgccaaaacttaaagcactt
tgcttgcaagccaaaagctataacattggtttaacggttgatgccgaagagtctgaacgt
ttagatatatcgcttgatattattgaagcggtatttagtgatggcgacttagccggttgg
gatggttttggtatcgccttacaagcgtatcaaaaacgcgctatttttgtggtcgattgg
ttacgtgaattaaccttacgtgtgaaccgtaaaatgatggtgcgtttagttaaaggcgct
tattgggataccgaaatcaaaaatgctcaaaaagatggccttcagcatttccctgttttc
acccgtaagtcttctaccgacgtgtcttatcacgcctgtgcgaataaattattagaatac
agagattctatctacccacagtttgccacccataatgcctacacagccgcaacgattgtt
gaattagccggtgatgataaagaaggtttcgaattccaatgtctacacggtatgggcgat
tcgttgtacgaccaaattgtgtcattggaaagtatacaatgtcgtatttacgcgccagtg
ggtcatcatgaagacttattagcgtatttggtacgtcgtttattagaaaatggcgcaaac
tcttcttttgttaacgctatcgttgatgagtcgcagccggttgagtctttattagaagat
ccggttgaaaaaactcaacgtttaaaagataaatataaccagcaaatcatcaagcctatt
gccttatatcatgataaaaaaggcttaggccgtgataactctaaaggcttagacttaacg
gatattaatgttattaccccgttaaaagtttcattagataattggtttgaagcaaacgaa
atcaagagtaacgacttacctgcgggtgctgtcgctgtgatgaacccagcaaatcacaaa
gagattattggctttcatcatcaccatagtaaagatgacatgctcgcgatgatagagacg
gcgcaaaccgcctttacttcatggtcacaaaccccggtagctgagcgcgccgcgttgttg
tgtcgtgttgctgatattctggaacgtcatactgacgagctaatcgctttatgtattaaa
gaagccggtaaaattgcccaagacggtattgatgaagtgcgtgaagcggttgatttttgt
cgttactacgccgagcaagcacttgaaattgcggccgacgaacgcgtagaagcgcgtggt
gttgtgctgtgtatcagcccatggaacttccctttagcgatattcttaggtcaagttgcc
gcggctattgccaccggtaataccgtattggctaaacctgctgagcaaaccagcttaatt
gcgctgcgcaccattgaattaatgaaatatgtcggcttaccagagggcgtagtacaagcg
gtgattgctcgtggtagcgaagtcggtagcgttattattcctgatgcgcgcattcaaact
gtgatgtttacgggttcgactgaaacgggcaccattatttcgcaaactttagcagacaga
ggtggcgaccaagtacctcttattgctgaaacgggcggccaaaactgtatgatagtggat
tcgaccgccttgccagagcaagtggttgacgatgtgatttcttcaggttttcaatcagcc
ggtcaacgctgctctgcgcttcgtgttttattcttacaagaagatatcgcggatgatgtt
attactatgctcaaaggcgctttagcagagttacatgtcggtaacccagaatacttaagc
accgacattggtccggtaattgaccaaaaagcactgtctgctcttaatgctcacagtgat
tacatgaaagaccatggcaagctgttgtaccaatgccctattggcgatgaaattaccaac
aacattgctgcaaacgaacatttcttttttgcgccacgtctttatgaaattgacgacatt
agtgtattaaagaaagaggtttttggtccatgtgtgcatgttgttcgctttaaaggcaat
gacatagagtctgttgttgataaaattaatggcacaggttttggcttaactatgggtatt
catacgcgtattgaacaccgtgcgttcgagctcgctaaattgtctcgtgcaggtaacgta
tatattaaccgcaacatgattggtgccattgttggcgtgcaaccttttggtggtcgaggc
ctttcaggtactgggccaaaagccggtgggccaaattatttatcccgtttagtgatagaa
aaagccacacctgatgctgagcaatttaacttattgccttcacaagtagaagcgctagac
ggtgatgcaaaatcagatgcagaatcagtattgtttatggataaagccaatgcggctgaa
aaagcatggcgtttaaccgaacttaacaaccgtatttcttgtgttcgtcaactgttagca
aaaattgcccatgttgatattgttgaagatttagccgacgatttaaaccgcaccttaaaa
tcagcgcgtgcacaattaatcaatattgaaaaacgcatgaaaaagccaacattcttacct
gggccaacgggtgagtctaatattttgtatttggaaaaccgcggcaatattatctgtttt
gcggataaaaatgtgagctttcacttctgggtactttctattgtaacggctttagcgacg
ggtaataccgtgataagtgttgtatcagacttgtactatgatgaagccatcgcctttaga
gataagtttctttcaaccggcgccgatgcaggggtatttcaagtggcccgcttacgtcac
ttatcaaccatgttatcgcaccctgcattagcgggtgtggttgttgatagtaactgtgat
cgtaaacattatatcagtgaaaaattagcggaacgtcaaggtgcaatattgccagtgatc
agttctgaatattttgataatttgatccaacgtttattaactgaaaaaaccgtcagtatt
gatacaaccgcttcaggtggtaacacgtcattaatgactttagttgaagaagattaa

DBGET integrated database retrieval system