KEGG   Colwellia sp. PAMC 21821: A3Q33_18645Help
Entry
A3Q33_18645       CDS       T04816                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
colw  Colwellia sp. PAMC 21821
Pathway
colw00071  Fatty acid degradation
colw00072  Synthesis and degradation of ketone bodies
colw00280  Valine, leucine and isoleucine degradation
colw00310  Lysine degradation
colw00362  Benzoate degradation
colw00380  Tryptophan metabolism
colw00620  Pyruvate metabolism
colw00630  Glyoxylate and dicarboxylate metabolism
colw00640  Propanoate metabolism
colw00650  Butanoate metabolism
colw00900  Terpenoid backbone biosynthesis
colw01100  Metabolic pathways
colw01110  Biosynthesis of secondary metabolites
colw01120  Microbial metabolism in diverse environments
colw01130  Biosynthesis of antibiotics
colw01200  Carbon metabolism
colw01212  Fatty acid metabolism
colw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:colw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3Q33_18645
   00630 Glyoxylate and dicarboxylate metabolism
    A3Q33_18645
   00640 Propanoate metabolism
    A3Q33_18645
   00650 Butanoate metabolism
    A3Q33_18645
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A3Q33_18645
   00072 Synthesis and degradation of ketone bodies
    A3Q33_18645
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A3Q33_18645
   00310 Lysine degradation
    A3Q33_18645
   00380 Tryptophan metabolism
    A3Q33_18645
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A3Q33_18645
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A3Q33_18645
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A3Q33_18645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:colw04147]
    A3Q33_18645
Enzymes [BR:colw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A3Q33_18645
Exosome [BR:colw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3Q33_18645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Kisspeptin Dodecin
Motif
Other DBs
NCBI-ProteinID: ARD46126
UniProt: A0A1V0KWL5
Position
complement(4474592..4475743)
Genome map
AA seq 383 aa AA seqDB search
MTQAYIVDALRSPTGRRKGSLAHVHAIDLGAAVLKALVERNDIPAQDYDDVIFGCVDTIG
SQAGNIARTSWLAAGLPVNVPGTTVDRQCGSSQQAVHFAAQAVMSGTQDVIAVGGVQTMT
QIPISSAMLAGQPLGFTTPFAESKLWHERFGDAPVNQFYAAQRIADHWDISRADMEAFAL
ESHRRALFATAEGRFDREIVPCEGLSHDETPRESNLAKMAELSPVDPAYPSITAAVSSSV
CDAAAAVLVVSERALKKYNLTPRARIHHISVLGDDPIWHLRAPIPATKAALAKANLTLDD
IDLVEINEAFASVAMAWLKETGYSHKKTNVNGGAIALGHPLGATGVRLMTGLLHELERTG
GRYGLQTMCEGGGLANVTIIERL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagcatatattgtagacgcattacgtagcccaacgggtcgacgaaaaggtagt
ttagcgcatgttcatgctattgatcttggtgccgccgttttaaaagcgctggttgagcga
aatgatattccagcgcaagattatgacgatgttatttttggttgcgttgacaccataggt
tcacaggcgggtaatattgctcgcaccagttggttggccgcgggtttacccgtgaatgtg
cccggcactactgtcgatagacaatgtggttcatcacaacaagcagtgcactttgctgcg
caagccgtgatgagtggcacgcaagatgtgatagcggttggtggtgttcaaaccatgacc
caaattcccatttcttcggcaatgttggcaggtcaaccgttaggctttacgactcccttt
gcggaaagcaaattgtggcatgaacgttttggtgacgcgcctgttaatcaattttatgca
gctcaacgtattgccgatcattgggacataagccgcgctgatatggaagcttttgcgctt
gaaagccatcgccgtgcattatttgccactgctgaaggtcgattcgatcgtgaaatagta
ccatgtgaaggcttaagccatgatgaaacaccgcgggaaagtaatctggctaaaatggca
gaactttcaccggtagatcctgcctatccgagtattacggcggcagtatcgagttcggta
tgtgatgctgcagccgctgtgttagtggtttcagaacgggcattgaaaaaatataattta
acgccaagagcccgaattcatcatataagtgtgcttggggatgatccaatttggcatcta
cgcgcgcctatcccggcaacgaaagcggcactggctaaagctaacttgacactcgatgat
attgatctggttgaaataaatgaagcatttgcttctgtagccatggcctggttaaaagaa
accggctatagccataagaaaactaatgttaatggtggtgccatagcacttgggcatcct
ttaggtgccacgggtgttagattgatgacgggcttactacatgaacttgaaagaacaggt
ggccgttatggcctacaaaccatgtgtgaaggcggcggtctcgctaatgtcaccatcata
gaacgattataa

DBGET integrated database retrieval system