KEGG   Colwellia sp. PAMC 21821: A3Q33_19055Help
Entry
A3Q33_19055       CDS       T04816                                 

Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
colw  Colwellia sp. PAMC 21821
Pathway
colw00640  Propanoate metabolism
colw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:colw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A3Q33_19055
Enzymes [BR:colw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     A3Q33_19055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ARD46200
UniProt: A0A1V0KWQ6
Position
complement(4584869..4587487)
Genome map
AA seq 872 aa AA seqDB search
MNYDYRKPLPGYKNNGLTIDFFDTREAIDTIKPGAYKTLPYTSRVLAEQLVRRCDPAALT
DALKQIIEGKQDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEQGGDPSKVNPVVPTQ
LIVDHSLAVEAPGFDPEAFEKNRAIEDRRNEQRFHFIEWTKTAFKNVDVIPAGNGIMHQI
NLEKMSPVIQARDGVAFPDTCVGTDSHTPHIDALGVIAIGVGGLEAETVMLGRPSMMRLP
DIIGVKLTGKRQPGITATDIVLAITEFLRNQKVVSAYLEFFGEGTKSLTIGDRATISNMT
PEYGASAGMFYIDEQTIDYLKITGREPEQVALVETYAKHTGLWADDLVEAQYPRVIEFDL
SSVGRNLAGPSNPHRRLATADLASKDIAKDLAACKEQEANGQMPDGAVIIAAITSCTNTS
NPRNVVAAGLIAKRANELGLVRKPWVKSSFAPGSKVAKLYLEEAGLLSEMEKLGFGIVGY
ACTTCNGMSGALDPKIQQEVIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYA
IAGTIRFDIEKDILGQDQNGNDITLKDIWPSDEEIDAIVASCVKPEQFKKIYTPMFDLGA
FEPAESPLYAWDETSTYIRRPPYWEGALAGERTMKGMRPLAVLGDNITTDHLSPSNAIQL
DSAAGAYLHKMGLPEADFNSYATHRGDHLTAQRATFANPKLFNEMCRDDKGEVKQGSLAR
IEPEGTESRMWEAIETYMERKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEVIVSEGFER
IHRTNLVGMGVLPLEFIKGETRHTYNIDGTETFDVEGTTSPGAAMSVVMTRRNGEVVTIP
VKCRLDTGEEVSVYAAGGVLQKFANDFLESTT
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgattaccgcaaacctttacccggttataaaaataatggcctaaccatagat
tttttcgatacgcgagaagccatcgataccattaagcccggcgcttataaaacattgcct
tacacttcgcgtgttctcgctgagcaattggttcgacgctgtgacccagctgcgctaacg
gacgcgttaaagcaaattatcgaaggtaaacaagaccttgatttcccttggtatcctgca
cgtgttgtttgtcacgatattttaggtcaaaccgcattagttgatttagccggcctgcga
gatgctattgctgagcaaggtggcgacccttcaaaagtgaatcctgtggtaccaacacag
ttaatcgttgaccattcattagcggtagaagctccgggttttgatcccgaagcatttgag
aaaaaccgagcgattgaagaccgtcgtaatgaacagcgttttcattttatcgaatggact
aaaacggcttttaaaaacgttgatgttatccctgccggtaacggcattatgcatcaaatc
aacttagaaaaaatgtcgcctgttatacaagcgcgggacggtgtcgctttccctgatact
tgtgttggtacagactctcatacgccgcacattgatgctttaggtgttatcgcaattggt
gttggtggcttagaagctgaaaccgttatgctaggtcgtccatctatgatgcgtttgcct
gatattattggtgtaaagctaacgggtaaacgccaacctggcattaccgcaaccgatatt
gttttagcgataactgaatttttgcgtaatcaaaaagttgtatcagcttatttagagttc
ttcggtgaaggcactaaaagtttaaccattggtgatcgtgcaactatctcaaacatgaca
ccagagtatggtgcgtctgccggtatgttttacattgatgaacaaaccattgattattta
aaaattactggtcgtgagcctgaacaagtcgcgctagttgaaacttacgcgaaacataca
ggtttatgggctgacgacttagttgaagcgcaatatccgcgtgttatcgaatttgattta
tcatcggtagggcgtaacttagcgggaccttctaatccacatcgtcgtttagcgacagct
gatttagcgtcgaaagacattgctaaagacttagccgcttgtaaagaacaagaagccaat
ggtcaaatgcctgatggcgcagttattattgccgctataacgtcttgtaccaatacctct
aatcctcgtaatgttgttgcggcgggtttgatagccaaaagagccaatgagcttggctta
gtgcgtaagccttgggttaaatcatcgtttgccccaggttcaaaagtcgccaagctttat
ttagaagaagccggtttgctttctgaaatggaaaaattaggttttggtatcgttggttat
gcttgtacaacttgtaatggtatgtctggcgcgttagaccctaaaattcaacaagaagtt
atagaccgcgatttatacgcaaccgcggtattgtcaggtaaccgtaacttcgatggccga
attcacccttatgcaaaacaagcgtttttagcgtcaccaccgttagtggtcgcttatgcc
attgccggtactattcgttttgatattgaaaaagatattttaggccaagatcaaaacggt
aatgacattacgctaaaagacatttggccaagtgatgaagaaattgatgctatcgttgct
tcatgtgttaagccagagcagttcaaaaaaatctatacgccgatgttcgatttaggtgcg
tttgagcctgctgaaagtccattatatgcttgggacgaaaccagtacttatattcgtcgc
ccgccatactgggaaggtgcattagcgggtgagcgtaccatgaaaggtatgcgtccatta
gcggtgttaggcgataacattaccaccgatcatttatcaccttcaaatgcgattcaatta
gacagtgctgccggcgcatatttgcataaaatgggcttgccagaagccgattttaactca
tacgcaacgcatcgcggtgatcacttaaccgcacaacgtgcaacctttgctaatcctaaa
ttgtttaacgaaatgtgccgtgatgacaagggtgaagttaagcaaggttcattagcgcgt
atcgagcctgaaggcactgaatcacgcatgtgggaagcaattgaaacttacatggaacgt
aaacaaccgctgattattatcgccggtgctgattacggtcaaggctcatcaagagattgg
gcggcaaaaggcgttcgtttagcgggtgttgaagtcattgtttctgaaggttttgaacgt
attcaccggacaaacttagtcggaatgggtgttttaccgcttgaatttattaaaggtgaa
acacgtcatacctataatattgatggtactgaaacctttgatgtggaaggtacaacatca
ccgggcgcagcgatgtcagtcgtgatgacacgtcgtaatggtgaagtcgtgactataccg
gttaagtgtcgattagatacgggtgaagaagtgtctgtttacgctgctggtggcgtatta
caaaaatttgctaacgacttcttggagtctactacctaa

DBGET integrated database retrieval system