KEGG   Colwellia sp. MT41: CMT41_04040Help
Entry
CMT41_04040       CDS       T04159                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
com  Colwellia sp. MT41
Pathway
com00620  Pyruvate metabolism
com01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:com00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMT41_04040
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:com02000]
    CMT41_04040
Enzymes [BR:com01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     CMT41_04040
Transporters [BR:com02000]
 Other transporters
  Primary active transporters [TC:3]
   CMT41_04040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ALO33983
UniProt: A0A0S2JDC1
Position
957408..959186
Genome map
AA seq 592 aa AA seqDB search
MSKPLGITEVVLRDGHQSILATRLRLADMLPIASTLDDVGYWSIESWGGATFDSCIRYLG
EDPWERIRALKKAMPKTKQQMLFRGQNILGYRHYADDVVEKFVERAHINGIDVFRIFDAM
NDVRNLQTSIKAAVKVGAHAQGTLSYTESPVHTLDGWLTMAKQIEDMGAHSLCIKDMSGL
LKPYDAEELISRLKETVSLPIALHCHATTGLSVATQMKAIDCDIDVIDTSISSMSMTYGH
SATETIAAIVEGGPRATGLNIEKMAEVAAYFRDVREKYAEFEGSLKGVDARILTAQVPGG
MLTNMESQLKEQGAADKFDEVLIEIPKVRKDLGYIPLVTPTSQIVGTQAVLNILTGERYK
SITKETAGVLKGEYGATPAPVNLELQTRVLDGKAVITCRPADLLDPEVDKLSVELQIIAK
EKGIKLADEIIDDVLTYALFPQIGLKFLENRNNPAAFEPIPTKDNTAGKVVSEKNSATAT
ENYAVSVDGKVYDVVVAPGGSIDAITHPAGDDAMKQSTSISAEETLNAPLAGNIFKVLVN
VGDYVEANDVVIIMEAMKMETEIRAVSAGEIVSVFTKEGDSVAVGDALLSFS
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccactaggtataactgaagttgtcttaagagatggacaccagtcaatttta
gcaactagactccgtttggccgacatgctacctatagcctcgacacttgatgacgttggt
tattggtcaatagagtcatggggcggagcaacatttgattcgtgtattcgatatttaggt
gaagatccttgggagcgcattcgtgcccttaaaaaagcgatgcctaaaaccaaacagcaa
atgttatttcgcggtcaaaatattttaggctatcgtcattatgctgatgatgtagtggaa
aaatttgttgaacgtgctcacatcaatggtattgatgtttttcgtatcttcgacgccatg
aatgatgtgcgtaacttacaaacctcaatcaaagccgcggttaaagtaggtgcacatgct
caaggcacactcagttataccgaaagtccagtgcatacgcttgacggttggctaacaatg
gccaaacaaatcgaagatatgggtgcacattctttgtgtattaaagacatgtctggcttg
ttaaaaccatacgatgccgaagagctgattagccgcttgaaagaaactgtttcattacct
atcgctctacactgtcatgcgacgacgggtttaagtgttgccacgcaaatgaaagcgatt
gattgtgatattgatgttatagacacttcaatttcttcaatgagtatgacttacggccat
tctgccacggaaaccattgcggctattgttgaaggtggtcctcgagctaccggactcaat
attgaaaagatggcggaagttgccgcatattttcgtgatgtaagagaaaaatatgctgaa
tttgaaggcagtttaaaaggtgtagatgcccgtatcctaacggcgcaagtgcccggtggc
atgttaaccaacatggaaagccagttaaaagagcagggcgcagctgataaatttgatgaa
gtattaattgaaataccgaaagtacgtaaagacttaggttatattcctttagttacccct
acctcacaaattgttggtacccaagcggtacttaatattttaaccggtgaacgttacaaa
tcgataaccaaagaaactgctggggtgttaaaaggtgaatatggtgcaacacccgcacca
gtcaacttagaactacaaacaagagttttggatggtaaagctgtgatcacttgtcgtcct
gctgatttacttgacccagaggttgacaaattatcagtagagctacaaattatcgccaaa
gaaaaaggcataaagttagcggatgaaattattgatgatgtcttaacttatgcattattc
ccgcaaatcggcttgaaattcttagagaatcgcaacaatcctgcggcatttgaacctatt
cctactaaagacaatacagctggcaaagtggttagtgaaaaaaactcggccacggcaaca
gaaaactatgccgtgagcgttgatggcaaggtttatgatgtagtagttgcgcctggtggc
tctattgacgctataactcatccagcgggtgacgatgctatgaagcaatctacgtctatt
tccgcggaagaaacgctgaatgctcctttagcaggtaacatctttaaggtcttagtcaat
gtaggcgactatgtagaagcgaatgatgtcgttatcattatggaagccatgaaaatggaa
actgaaattcgcgcggtaagtgccggtgaaattgtatcggtatttaccaaagaaggtgac
tcagttgctgttggtgatgccttacttagcttttcttag

DBGET integrated database retrieval system