KEGG   Colwellia sp. MT41: CMT41_05040Help
Entry
CMT41_05040       CDS       T04159                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
com  Colwellia sp. MT41
Pathway
com00260  Glycine, serine and threonine metabolism
com00630  Glyoxylate and dicarboxylate metabolism
com00670  One carbon pool by folate
com01100  Metabolic pathways
com01110  Biosynthesis of secondary metabolites
com01130  Biosynthesis of antibiotics
com01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:com00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CMT41_05040 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CMT41_05040 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CMT41_05040 (gcvT)
Enzymes [BR:com01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CMT41_05040 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: ALO34168
UniProt: A0A0S2JE77
Position
1184584..1185672
Genome map
AA seq 362 aa AA seqDB search
MTNKTVLHAKHLASGAKMVDFYGWEMPINYGSQIEEHHAVRKSAGMFDVSHMTIVDVQGT
DAKAFLRRLVINDVAKLTIPGKALYTGMLNEAGGVIDDLIIYFFSDTNYRLVVNSATREK
DLAWMTKQATGFDITITERPEFGMIAVQGPEAIAKVGTLLSAEESAAVEGMKPFFGVQVG
DLFIATTGYTGELGYEIILPESATEDFWQKLLDAGVAPCGLGARDTLRLEAGMNLYGLDM
DESVSPIAANMAWTISWEPTDRDFIGREVLTAQKAAGDQPKLVGLVLEEKGVLRTAQKVI
TEAGEGIITSGTFSPTLGHSVALARVPRSVKVGDVVEVEMRKKLVKVTVTKPSFVRNGKK
VF
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactaataaaacagtattacatgcaaagcatttagcttcaggcgcaaaaatggttgat
ttttatggctgggaaatgccaattaactatggctctcaaattgaagagcatcatgcggta
agaaaaagtgccggtatgtttgatgtttcacacatgaccattgttgacgtgcaaggcaca
gatgcaaaagcttttttacgtcgtttagtgattaacgatgttgctaagttaacaatccca
ggaaaagcgttatacacaggtatgttaaatgaagctggtggtgtgattgatgatttgatc
atttacttcttctccgacactaactaccgcttagttgttaactcggcaacacgtgaaaaa
gatcttgcttggatgactaagcaagcaactggttttgatattactattactgagcgtcct
gagtttggcatgattgccgtacagggcccagaagctatcgctaaagtcggtactttactt
tctgctgaagaaagtgctgccgttgaaggcatgaagccattttttggtgtacaagtaggt
gatttatttatcgccactaccggttataccggtgaacttggttacgaaattatccttccg
gaaagtgctacagaagatttctggcaaaaattattagacgctggcgtagcgccatgtggc
ttaggtgcccgtgatactttacgtttagaagccggcatgaacctttacggtttagatatg
gacgaaagcgtttcgcctatcgcagctaacatggcctggaccataagctgggaaccaaca
gaccgtgattttatcggtcgtgaggtattaactgcacaaaaagctgccggtgaccaacct
aagttggttggtttagtattggaagagaagggcgttttgcgtaccgcgcaaaaggttatt
actgaagctggcgaaggcatcatcacttcaggtactttctcaccgacactaggtcacagt
gttgctttagcgcgtgtacctcgcagcgtaaaagtaggtgatgtggttgaagttgaaatg
cgtaagaaattagttaaagttactgtgacaaaaccaagctttgttcgtaacggcaaaaaa
gtattctaa

DBGET integrated database retrieval system