KEGG   Colwellia sp. MT41: CMT41_06180Help
Entry
CMT41_06180       CDS       T04159                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
com  Colwellia sp. MT41
Pathway
com00071  Fatty acid degradation
com00072  Synthesis and degradation of ketone bodies
com00280  Valine, leucine and isoleucine degradation
com00310  Lysine degradation
com00362  Benzoate degradation
com00380  Tryptophan metabolism
com00620  Pyruvate metabolism
com00630  Glyoxylate and dicarboxylate metabolism
com00640  Propanoate metabolism
com00650  Butanoate metabolism
com00900  Terpenoid backbone biosynthesis
com01100  Metabolic pathways
com01110  Biosynthesis of secondary metabolites
com01120  Microbial metabolism in diverse environments
com01130  Biosynthesis of antibiotics
com01200  Carbon metabolism
com01212  Fatty acid metabolism
com02020  Two-component system
Brite
KEGG Orthology (KO) [BR:com00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMT41_06180
   00630 Glyoxylate and dicarboxylate metabolism
    CMT41_06180
   00640 Propanoate metabolism
    CMT41_06180
   00650 Butanoate metabolism
    CMT41_06180
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CMT41_06180
   00072 Synthesis and degradation of ketone bodies
    CMT41_06180
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CMT41_06180
   00310 Lysine degradation
    CMT41_06180
   00380 Tryptophan metabolism
    CMT41_06180
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CMT41_06180
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CMT41_06180
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CMT41_06180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:com04147]
    CMT41_06180
Enzymes [BR:com01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CMT41_06180
Exosome [BR:com04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CMT41_06180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALO34366
UniProt: A0A0S2JFG1
Position
1459270..1460454
Genome map
AA seq 394 aa AA seqDB search
MSSSDPIVIVSAVRTPMGGFGGCFASVTAPDLGANAIKAAVAQANLAADQIDEVIMGCVL
PAGLKQAPARQAAIAADLSLSTVCTTINKVCGSGMKAVMQAHDALLAGSIDTAVAGGMES
MSNAPYILPKARTGLRMGHGQVIDHMMQDGLENAYDGIAMGCFAQDTADEANFTREAMDE
FAIRSLSRANQAIESGAFKNEITAVTVKNRRSEVVIDTDEQPGNARPDKIPSLRAVFKKD
GTITAANSSSISDGAAALVMMKLSEAKSRDLTPLCKIVAHATHAQAPSEFTVAPVGAMSK
VLAKANWSTDDVDLFEINEAFAMVTMLAVKEMSLDINKVNIHGGACALGHPLGASGARIM
VTLIHALKNKGLSKGVASLCIGGGEATAIALEML
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatctgatcctattgttattgtttccgcggtaagaacccctatgggcggtttt
ggcgggtgctttgccagcgttactgcgcctgacctaggtgctaatgcaattaaagctgca
gtcgctcaagctaacttagccgctgaccaaattgacgaggtcattatgggctgtgtttta
cctgctggtttaaaacaagcaccggctagacaagctgcaattgctgcagatttatcttta
tcaaccgtttgtaccactatcaataaagtgtgtggttcaggtatgaaagcggttatgcaa
gcacacgatgctttacttgctggctctatcgatacagcagtggccggcggtatggaaagt
atgagtaatgcgccttatattttacctaaagcaagaacaggtttgcgtatgggccatggc
caagtcattgatcatatgatgcaagacggtttagaaaatgcgtatgacggcattgctatg
ggctgttttgcccaagatactgctgatgaagcaaactttactcgtgaagctatggatgaa
tttgccatacgttcacttagtcgagctaaccaagcgattgaatcgggtgcttttaaaaat
gaaataacagccgtgacggtgaaaaatcgtcgtagcgaagtggttattgataccgatgag
caaccgggtaatgcacgcccagataagattccttcgttacgtgcagtctttaaaaaggac
ggtactattactgccgctaactctagctccatttctgacggcgcagcagcgctggttatg
atgaaactatctgaagcaaaatctcgtgatttaacaccactttgtaaaatagttgcccat
gccactcacgcacaagcaccaagcgagtttactgtggcaccggtaggggctatgagtaaa
gtgttagctaaggctaattggtctaccgatgatgttgatttgtttgaaattaatgaagcc
tttgctatggtaactatgttagcggttaaagaaatgtcattagatattaataaagtaaat
attcatggcggcgcctgtgcgctcggtcatccattaggtgcaagtggcgcccgtattatg
gtgaccttaattcacgctttaaaaaataaaggtttatctaaaggggtagcttccctttgt
attggcggcggtgaagcaactgctattgccttagaaatgctgtaa

DBGET integrated database retrieval system