KEGG   Colwellia sp. MT41: CMT41_06870Help
Entry
CMT41_06870       CDS       T04159                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
com  Colwellia sp. MT41
Brite
KEGG Orthology (KO) [BR:com00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:com03009]
    CMT41_06870
Enzymes [BR:com01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CMT41_06870
Ribosome biogenesis [BR:com03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    CMT41_06870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 PrmA Methyltransf_12 AdoMet_MTase Methyltransf_32 Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: ALO34470
UniProt: A0A0S2JEM4
Position
complement(1603757..1604572)
Genome map
AA seq 271 aa AA seqDB search
MHTENLAQYRCPLCQQALLLTEKSYRCINKHSFDQAKQGYVNLLPVQFKHSKEPGDNKAM
VQARRAFLDKGYYQPLLDSMLALYQKYGDKTAAVFDAGCGEGFYTHQHKTEHNSVYGVDI
AKETIKIAAKRYQDCFYSVATLADLPFNDGHFGWLYSVYAPILENEFTRILQDKGYLLTV
TPADNHLFELKALIYRQANKHDTAKQVIKQLTLIEEQRLNYPMNFSNSDDVLNLLAMTPF
AFKASKELINKLKQQKEFSCQADFVLRLYQK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcatactgaaaacctagcgcaataccgatgcccgctttgccaacaagccttgttactt
actgaaaagagctaccgttgtataaataagcacagctttgatcaagcaaaacaaggctat
gtaaacttattaccggttcaatttaagcactcaaaagagcctggcgataacaaggcaatg
gtacaagctagacgggcatttttagataaaggctattaccagcccttgcttgacagtatg
ttagcgctctatcaaaagtatggtgataaaaccgccgccgtttttgatgctggctgtggt
gaaggtttttatactcatcagcataaaactgagcataatagtgtctacggcgttgatatt
gccaaagaaacgataaaaatagccgcaaaacgctatcaagattgtttttatagcgtggca
acacttgctgacttgccttttaatgatggccattttggctggctatatagtgtttacgcc
cccattttagaaaatgagtttactcgtattttacaagacaagggttatttgttgacggtt
acaccggccgataaccatttatttgagcttaaagcactgatatatcgccaggcgaataaa
catgacactgcaaaacaagtaattaagcaattaaccttgattgaagaacaacgcttaaat
tacccgatgaacttctctaatagtgacgatgtgttgaatttattagcaatgacacccttt
gcctttaaagccagtaaagagttaattaacaaattaaagcaacaaaaagaattcagttgc
caagctgattttgttctgcgcttatatcaaaagtaa

DBGET integrated database retrieval system