KEGG   Colwellia sp. MT41: CMT41_08205Help
Entry
CMT41_08205       CDS       T04159                                 

Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
com  Colwellia sp. MT41
Pathway
com00640  Propanoate metabolism
com01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:com00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CMT41_08205
Enzymes [BR:com01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     CMT41_08205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ALO34699
UniProt: A0A0S2JFA3
Position
1906626..1909268
Genome map
AA seq 880 aa AA seqDB search
MNYQYRKPLPGYKNKGATIDFYDTRAAIEAIKPGSYVKLPYTSRILAEQLVRKCDPAILT
DSLKQIIEVKQDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEQGGDPSKVNPVVPTQ
LIVDHSLAVEASGSDPQALAKNRAIEDRRNEQRFHFIEWTKTAFKNVDVIPAGNGIMHQI
NLEKMSPVIQARDGIAFPDTCVGTDSHTPHIDCLGVLAIGVGGLEAETVMLGQPSMMRLP
DIIGVKLTGKCQPGITATDMVLAITEFLRNEKVVSAYLEFFGEGTKNLTIGDRATLSNMT
PEYGASAGMFYIDEQTIDYLKITGRDPEQIKLVEIYAKHTGLWADDLKEVQYPRVIEFDL
STVCRNLAGPSNPHRRLATADLVSKDIAKNLDVCKAQEANGQLPDGAVIIAAITSCTNTS
NPRNVVAAGLVAKRANELGLVSKPWVKTSFAPGSKVAKLYLEEAGLLSEMEKLGFGIVGY
ACTTCNGMSGALEPKIQQEIIDRDLYTTAVLSGNRNFDGRIHPHAKQAFLASPPLVVAYA
IAGTIRFDIEKDILGQDQQGNDITLKDIWPADEEIDAIVASCVKPEQFKKVYEPMFDLGA
FEPAESPLYDWDETSTYIRRPPYWNTEGPGALAGVRTMKGMVPLAVLGDNITTDHLSPSN
AIQLDSAAGAYLAKMGLPEADFNSYATHRGDHLTAQRATFANPKLFNEMCRDENGKVKQG
SLTRIEPEGTESRMWEAIEIYMERKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEVIISE
GFERIHRTNLVGMGILPLEFTNGDTRHSYNIDGSETYDVEDTHVKGISPGGAMTVIMTRR
NGEIINIPVKCRLDTADEVSVYAAGGVLQKFANDFLKSNA
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaattaccaataccgcaaaccgttgcccggttataaaaataagggcgcgaccatagat
ttttatgatacgcgtgcagctatcgaagccattaaaccaggctcttacgttaaattacct
tacacttcacgcatacttgctgagcaattagtgcgtaaatgtgatccggcgatacttacc
gattcattaaagcaaattatcgaagttaagcaagaccttgattttccatggtatccggca
agagttgtttgtcatgatattttaggacaaaccgccttagtcgatttggctggtcttcgt
gacgctattgccgagcaaggtggcgatccctcaaaagtaaacccagtggtaccgacacaa
ttaatagtcgatcactctttagccgttgaggcttctggctctgatcctcaagcgttggct
aaaaaccgtgccattgaagatcgccgtaatgaacagcgttttcatttcattgaatggact
aaaacagcctttaaaaacgttgatgttattcccgctggtaacggtattatgcatcaaatc
aacttagaaaaaatgtcgccagttattcaagcgcgtgacggcattgctttccctgatact
tgtgttggcaccgattctcatacaccacatatagattgtctcggggttcttgccattggt
gttggtggcctagaagctgaaacagttatgctgggtcaaccctctatgatgcgtttaccc
gacattattggtgttaagttaacgggcaagtgtcagcccggtattacggcgaccgatatg
gtcttagccatcacagaatttttacgtaatgagaaagttgtctctgcttacttagagttt
ttcggtgaaggtactaaaaacttaaccataggtgaccgggcaacactctcaaacatgacg
ccagagtacggtgcctcagccggtatgttctacattgatgaacaaaccattgattacttg
aaaattaccggtcgtgatccagagcaaatcaaactggttgaaatttatgctaaacatacc
ggtctttgggctgatgacctaaaagaagtacagtaccctcgtgttatcgaatttgattta
tcaactgtctgtcgtaacttagccggaccttcaaatccgcatcgtcgtttagcgaccgct
gatctagtgtcgaaagacattgcgaaaaatttagatgtttgtaaagcacaagaagccaat
ggtcaactgccggatggtgcggtaattatcgctgcgatcacctcatgtaccaatacctca
aatccacgtaacgttgttgccgcgggtctggtggctaaacgggctaatgaattaggttta
gtaagtaaaccttgggtaaaaacatcatttgcgccgggctctaaagtagcgaaactgtat
ttagaagaagcaggtctgctcagtgaaatggaaaaattaggctttggtatagtaggttac
gcctgtactacctgtaatggtatgagtggcgcgttagagccaaaaattcagcaagaaatt
atcgaccgtgatttatacactaccgcggtattatcaggtaaccgtaactttgatggtcgt
attcatccgcatgcaaaacaagctttcttagcatcaccgccattagttgttgcttatgct
attgccggtaccatacgttttgatattgaaaaagacattctaggtcaagatcaacagggt
aacgatattaccttgaaagatatttggccagcggatgaagaaattgatgcaattgttgct
tcatgtgtcaagcctgagcaattcaagaaggtttatgaacccatgtttgatttaggtgcc
tttgaaccagctgaaagcccattatatgattgggatgaaaccagtacttatattcgtcgt
cctccttactggaataccgaggggccgggtgcattggccggtgttcgcaccatgaaaggt
atggtgccattagcggtgcttggcgataacatcactacagatcatttatcaccctcaaat
gctattcaattagacagtgctgcgggtgcctacctcgctaaaatgggtctacctgaagcc
gactttaactcatacgccactcacaggggcgatcacttaacggcacaacgtgccaccttt
gccaacccgaaacttttcaatgaaatgtgtagggacgaaaacggtaaagtcaagcaaggc
tctctcactcgtattgagcctgaaggcactgaatcacgcatgtgggaagccattgaaatc
tacatggaacgcaaacagccattaatcataattgccggtgctgactacggtcaaggctct
tcacgtgattgggcggcaaaaggtgtgcgtttagccggtgttgaagttatcatttctgaa
ggtttcgagcgtattcaccgcactaacctagtgggtatggggatattacctttagaattt
accaacggtgatactcgccatagctataacattgacggcagcgaaacgtacgatgttgaa
gacactcatgttaaaggtatttcaccaggtggggcaatgactgtcattatgacgcgtcga
aatggtgaaataattaacatcccagtgaaatgtcgtttagataccgctgacgaagtttcg
gtatacgccgccggtggggtattgcaaaagtttgccaatgattttcttaaatctaatgcc
taa

DBGET integrated database retrieval system