KEGG   Colwellia sp. MT41: CMT41_08440Help
Entry
CMT41_08440       CDS       T04159                                 

Definition
(GenBank) exodeoxyribonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
com  Colwellia sp. MT41
Pathway
com03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:com00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CMT41_08440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:com03400]
    CMT41_08440
Enzymes [BR:com01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CMT41_08440
DNA repair and recombination proteins [BR:com03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CMT41_08440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 ResIII
Motif
Other DBs
NCBI-ProteinID: ALO34738
UniProt: A0A0S2JFC7
Position
1973193..1977065
Genome map
AA seq 1290 aa AA seqDB search
MTHLNTPDANQVVNNLDNKVASATLTLKNLDAATIPLSGKHLIEASAGTGKTYNITRIYL
RLLLERELTVEQILLMTFTKDATQELRGRIDSFIRLALSDWQVLCVDDPYFTALDKRIDK
SKREFLLKRALLFLDEAAIFTIHGFCQRVLNQYAFTSGLPFNANMAANSTEITLQVCQDW
YRSLAKSDADSFMLLASFWATPESFLSSFSKAIGHSSTLSVIDVESIAAEFITLVRQAHE
NLTTHSDLFENALILVKKGAEQDKRRSELAQLNTWLVSIIDQELSLMAVGEGKVKMPDAF
FDGKRYARSTYKAELLVAFAPVKQVKEQVKKIANKINKAKAYTIVKSGIYNIRQQVITQK
QALNLLDFDDLINTLAYCLSSACLTDKGANKECSNDESSSDDNTNQLAKQLLAQYPVALI
DEFQDTDPKQFGILQAIYYGDNAVKANAALFLIGDPKQAIYGFRGGDIFAYLNARSGCDY
HWLMDTNWRSTPEMIAGYNQLFSKKAKAARPEDATGKLSESVFGFGIPYLPVLAGKKSAS
ANQENAESGQVLADSDKALQFIHFTDHEQPDSKVSQGSRPMMANWCANEIVTLLTSNEHA
AKPKDIAILVRDGAEARDIKQALEQAGLDSVFLSDRANLFHSEQARQLLCLLKGVLLPEN
ERLFVAALSCGLLGYDAQKLYQLQQDELAYQTMKFAFVDYRSQWQRQGFITMAITLMHNL
LDVPLRNKDRCLTNILHLFEILQAASVRLSQGQELLHWFEQQCHAESNDVEAELRLESDG
DLIRLITQHGSKGMEYPYVFIPFACRHKDPLKFGNKAVSYLEYHDKHGNLCLSLDGSKEA
KQAMSNEAYAESIRLLYVAITRAERRCYILCCAFDGYHLSPLGKTLQLQEQDSIIKGLAV
VKAGAEHAIGIRQVSLDCPLDDNGQVLKQLENNSQESVNSAVSQFTGTIERDWWLSSFTA
LSRNIRHAGVSNPDRDTDTTQSQLATLSNSPLGNSELAALTHGQQICFKLAKGAHTGNLL
HDILEQTDFTAPNWQESVEKPLLVYGELTSGGVNTSDNTSFTEDDLIAWLEQVLNSAFIS
NDDNDNYASLSDLDLNKTLRESEFYFPMQGEGTSALAKLLTDHRNSAERNINSSDSKTST
SSSTNTSTLTLKYPVMLPSHKKLSGMMHGFIDLIFEYQGKYYLCDYKSSHLGDSFQDYQY
DALLDNVEKNYYDLQYLIYSLALHRYLKQTLSDYQPSKHFGGVYYLYLRGMTTEPEHQGA
GVYYRKISVQELNNLDALFAHENSEAAQDD
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccttaatactcctgacgctaaccaagtagttaacaaccttgataacaaggta
gctagcgcaacactaacgctgaaaaatcttgatgcggctactatcccattaagtggtaaa
catctaatcgaagccagtgccggtactggcaaaacctataatattactcgaatctattta
cggttattacttgagcgcgagctaacggttgaacaaatattattgatgaccttcaccaaa
gatgccacgcaagagttacgagggcgcattgatagctttattcgccttgccttgagtgat
tggcaggtattgtgtgttgatgacccttattttaccgccctcgataaacgcatcgacaaa
agcaagcgcgaatttttattaaaacgtgcgttactttttttagatgaagcggccattttt
accatccatggcttttgccaacgggtattaaatcaatatgcttttaccagtggtttacct
ttcaatgccaatatggcggcgaactcaacagaaatcaccttgcaagtgtgccaagactgg
tatcgcagtttagctaaaagcgatgctgatagttttatgctgttggcgagcttttgggcg
acaccggaaagctttttatcaagctttagtaaagccatagggcacagcagtactttatcg
gttatcgatgttgaaagtattgccgctgaatttattaccctagtacgccaggctcacgaa
aatttaaccacacacagcgatttatttgaaaatgcgctgatcctggttaaaaagggcgca
gagcaagataaaaggcgcagcgagctggcgcaattaaacacttggctggtaagtattatc
gaccaagagttatcactgatggctgtcggtgaaggcaaagttaaaatgcccgatgctttt
tttgatggtaaacgttatgccagatccacttataaagctgaattgcttgtcgcttttgca
ccggtaaaacaagtgaaagagcaggttaagaaaattgccaataaaatcaataaagcgaaa
gcttataccattgttaaatcaggtatttataacattcgccagcaagtgatcacacaaaag
caagcgcttaatttactcgattttgacgatctaattaataccttagcctattgtcttagc
tctgcttgtttgactgataaaggtgccaacaaagaatgttccaacgatgaaagctcaagt
gatgacaataccaatcaactggctaaacaattactggcgcaatacccggtcgctttaatt
gatgagtttcaagataccgaccctaaacagtttggtattttgcaagctatctattatggc
gataacgcggtaaaagccaatgcagctttatttcttattggcgatcctaagcaagctatc
tatggttttcgtggcggtgatatttttgcctacttaaatgcccgtagtggctgtgactac
cattggttgatggatactaattggcgctcaacgcctgaaatgattgccggttataatcag
ctttttagcaagaaggctaaagcagcaaggcctgaagatgctactggcaaactaagcgag
agtgtctttggttttggtattccttatttacctgtgctggccggtaaaaaatcagctagt
gccaaccaagaaaatgctgagagcggacaagtgttagcagacagtgataaagcgctgcag
tttattcattttactgaccatgaacaaccagatagcaaggttagtcaaggctctcggcct
atgatggctaactggtgtgccaatgaaatagtgaccttgctcacctcgaacgagcatgcg
gccaagccgaaagatattgccatattagtcagagatggcgctgaagcgcgtgatataaaa
caagcccttgagcaagcgggtcttgatagtgtctttctatctgaccgagccaatttattt
cattccgagcaagccaggcaattgttatgtttacttaaaggtgtactgttacccgaaaat
gaacgcttgtttgttgcggcattatcatgtggtttattgggctatgatgcacaaaaactg
tatcagctgcagcaagatgaactggcctatcaaaccatgaaatttgcttttgtcgattac
cgtagccaatggcaacgacaaggttttattaccatggccattactttaatgcacaatctg
cttgatgtaccgctacgcaataaagatcgttgtttaaccaatattttacatttatttgaa
atattacaggcggcgagtgtgcgcttaagtcaggggcaagagctgttacattggtttgaa
cagcaatgtcatgccgagtcgaatgacgttgaagccgagctgcgtttagaaagtgacggc
gaccttattcgtttaattacccagcatggctcgaaaggcatggaatatccttatgtgttt
attccgtttgcttgtcgtcataaagatcctctcaaatttggtaataaagcggttagttat
cttgagtaccatgataaacacggtaatttgtgtttaagcctagatggctccaaagaagct
aaacaagccatgagtaatgaagcttatgcagaaagtattcgtttactgtatgtagcgata
acgagggcagagcgacgttgttatatcctctgttgtgcttttgatggctatcatttatca
cctttaggtaaaacgctacaactacaagagcaagacagcattattaaggggctagcagta
gttaaagcaggtgctgagcatgccattggtattcgtcaggtctcacttgattgtcccctt
gatgataatgggcaggtgttaaaacaattggaaaataacagtcaagagtcggtcaatagc
gcggttagtcaattcaccgggaccatagagcgagattggtggttgagttcttttactgcc
ttaagccgcaatattcgtcatgccggtgtttctaatcctgaccgagatacggatactacc
cagagccagctagccaccttgagcaatagcccgctaggtaatagcgagcttgccgcgtta
actcacgggcaacaaatttgtttcaaattagctaagggtgctcataccggtaacttatta
catgatattttagagcaaactgattttactgcacccaactggcaagaaagtgtagaaaaa
ccgttgttagtttatggtgagttaactagtggcggggtaaataccagtgacaatacctcc
tttactgaagatgatttaattgcctggttagagcaagtgcttaatagcgcttttattagc
aatgatgataatgacaattatgccagtcttagcgatctggacttgaataaaaccttgcgt
gaaagtgagttctattttcccatgcaaggcgagggcaccagtgccttagctaaattgcta
accgatcaccgaaatagcgcggaacgtaatattaatagcagtgacagcaagacatcaact
agcagctctactaatacctcaactctaacgttaaagtatccagtgatgttacctagccat
aaaaagcttagcggcatgatgcatggttttatcgatttgatttttgaataccaaggtaaa
tattacttgtgtgattataaatctagccacctaggtgatagctttcaagactatcagtat
gatgctttactcgataatgtggaaaaaaactattatgacttacaatatctgatttactcc
ttagcactacatcgctatttaaagcagacccttagtgattatcagcccagtaaacatttt
ggtggtgtctattatttatatcttcgtggtatgacgacagagccggagcatcaaggtgct
ggggtgtattatcgtaaaatttcggtgcaagaattaaataatttagatgcactatttgca
catgaaaatagcgaggcagcgcaagatgactga

DBGET integrated database retrieval system