KEGG   Colwellia sp. MT41: CMT41_12600Help
Entry
CMT41_12600       CDS       T04159                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
com  Colwellia sp. MT41
Brite
KEGG Orthology (KO) [BR:com00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:com03016]
    CMT41_12600
Enzymes [BR:com01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CMT41_12600
Transfer RNA biogenesis [BR:com03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    CMT41_12600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ALO36688
UniProt: A0A0S2JL39
Position
complement(2941762..2942577)
Genome map
AA seq 271 aa AA seqDB search
MLTILYQDEFMVAVDKPAGLFVHRSFMDKDEIYFALQLVRDQIGQYVYPVHRLDRPTSGV
LLFALTKEVATLLNQAFANKSSQAEHRPKLDSELDAELAPKFAPQDNIEASGMVKTYYAL
VRGHLAVPTGFIDHPLKEKLDKLGDKNVSRDKPAQSAQSYYQVKQQVSLPIKVGKFDSVR
YSLVEVQPVTGRRHQIRRHLAHLRHPIIGDINYGDNKQNPFFIAHFGFKRLMLHAQSLTF
NHPVSDKRLTISAPFDQQWQQLFTELKWPVI
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgcttactattttatatcaagatgagtttatggtggcagttgataaacctgcaggttta
tttgtccatcgtagctttatggataaagatgaaatctattttgctttgcaattagtacgg
gatcaaatcgggcaatatgtctatcctgtccatcgtttagatagaccaacgtcaggcgtg
ctgttgtttgccttaacgaaagaggtagccactctgctcaatcaagcttttgccaataaa
agtagccaagctgagcataggcctaaacttgattctgaacttgatgccgagcttgcgccg
aaattcgctccgcaagataacatcgaagccagtggcatggtgaaaacctattatgcgcta
gtacgtggtcacttggcggtgccaactggtttcattgatcacccattgaaagaaaaactg
gataaattaggcgataaaaatgtgagtcgtgataagcccgcacaatcggcacaaagctac
tatcaagtaaagcagcaagtgagcttgccaatcaaggttgggaaattcgatagcgtgcgt
tattctctagttgaagtacagccagttactggtaggcgtcatcaaattcgtcgtcatcta
gcgcatttacgccatcctattataggtgatatcaactatggcgataacaagcagaatccg
ttttttattgcacacttcggctttaaacgcttaatgctgcacgcacagtcattaacgttc
aatcatccggttagcgataaaagattaaccatatcagcgccgtttgatcagcaatggcaa
cagctttttactgaattgaaatggcccgtcatttaa

DBGET integrated database retrieval system