KEGG   Confluentimicrobium sp. EMB200-NS6: TQ29_02260Help
Entry
TQ29_02260        CDS       T04096                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K12454  CDP-paratose 2-epimerase [EC:5.1.3.10]
Organism
con  Confluentimicrobium sp. EMB200-NS6
Pathway
con00520  Amino sugar and nucleotide sugar metabolism
con01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:con00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TQ29_02260
Enzymes [BR:con01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.10  CDP-paratose 2-epimerase
     TQ29_02260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 KR adh_short NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ALG89209
UniProt: A0A0N9NPQ2
Position
447472..449457
Genome map
AA seq 661 aa AA seqDB search
MSRFGFVEWFRPGDRERVEAVLPMLEETGASWLRTHLSWADYHAPGGPEWYDWLIPRLSR
NLELVPCVHYTPPSLSRTGRTSGAPKVLKDLPDFCDTVMSRYGAHFEHLELWNEPNNLLD
YDWREDPGFELFCEMIDMAAYWIRERGWKPVLGGPCPFDPYWLDLMGQRGILSYMHAVGF
HGFPGTWDSEEGSWTGWDMHLGEMRAILDRHNRDAEIWITETGYSTWRRDEMEQVRRFMQ
ALDAPAARIFWYGWQDLQPDVAVQEGLWFDPRHYHLGAITADGQPKLLARMLAEGGVARL
REVTRLSFPALAGGKRPVVVTGGAGFIGSNLSESLLADGQEVLVLDNLSRPGVEENLGWL
SAHFGARVHPAPFDLRDTQALNSAVRDAAAVFHLAAQTAVTTSLDTPVEDFEVNARGTLN
VLEAVRASGREIPLVFASTNKVYGALADIDLHETAECVVPADAAQGRGVTECRPLDFCTP
YGCSKGVADQYVMDYAHSYGLKAAVLRMSCIYGPRQFGTEDQGWLAHFLISALRGDPLTI
YGSGRQVRDVCEVSDAVAAYRMVHDRIDALSGRAFNLGGGPANAISLRQALAEITRVTGV
TPEVVYRDWRQGDQPWFVADTAALTAATGWRARTDWRQGIARLAGWLAEHRVHPEPERIL
A
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcttcggcttcgtcgaatggtttcgcccgggcgaccgggagagggtggaggcg
gtgctgccgatgctggaggaaaccggtgcctcgtggctgcgcacgcatctgtcctgggcc
gattaccacgcgcctggcgggcccgaatggtacgactggctgatcccgcgcctgtcgcgc
aacctcgagctggtgccctgtgtccactacacgccaccgtcgctgtcgcgcacggggcgc
acgtcgggcgcgccgaaggttctgaaggacctgccggatttctgcgacaccgtgatgagc
cgctatggcgcgcatttcgagcacctggagttgtggaacgagcccaacaacctgctggat
tacgactggcgcgaggacccggggttcgagctgttctgcgaaatgatcgacatggctgcc
tactggatccgggaacgcggctggaaaccggtgctgggcgggccctgtccgttcgatccc
tattggctggacctgatgggccagcgcgggatcctgtcctacatgcacgcggtcggattt
cacggctttccaggaacctgggacagcgaagagggatcctggaccggctgggacatgcat
ctgggagaaatgcgcgcaatcctcgacaggcataaccgggacgcggagatctggatcacg
gagaccggctattcgacctggcgtcgcgacgagatggagcaggtacggcgtttcatgcag
gcgctcgacgcgcccgccgcgcggatcttctggtacggctggcaggatctccagcccgac
gtggcggtgcaggaaggcctgtggttcgatccccggcactatcatctgggcgcgatcacc
gccgacggacagcccaagctgctggcacgcatgctggccgagggcggggtcgcgcggctg
cgcgaggtcacccggctgtcctttccggcactggccggtggcaaacggcccgtggtggtg
accggcggcgcgggtttcatcgggtccaatctcagcgaaagtctccttgcggacggacag
gaggtcctggtgctcgacaacctctcgcgaccgggtgtggaggagaacctcggctggctc
agcgcccatttcggggcccgggtccatcccgcgccgttcgacctgcgcgatacgcaggca
ttgaacagcgctgtccgggacgccgcagcggttttccatctggcggcgcagaccgccgtg
accaccagcctcgacaccccggtcgaggatttcgaggtgaacgcgcgcgggaccctgaat
gtgctggaggccgtgcgcgcctcgggacgcgagatacctttggtcttcgcctcgacgaac
aaggtttacggggccctcgccgacatcgacctgcatgaaacggcggagtgcgtggtgccc
gccgatgccgcgcaaggccggggcgtgaccgaatgtcgtccgctcgatttctgcaccccc
tatggctgttccaagggcgtggcggaccagtacgtgatggattacgcgcatagctacggg
ctgaaggccgcggtgctgcggatgtcctgcatctacggtccgcgccagttcggtactgaa
gaccagggatggctcgcgcatttcctgatctcggcgctgcgcggcgatcccctgacgatc
tacggttccggccgacaggtccgcgacgtctgcgaagtctcggacgccgtggctgcctat
cgcatggtgcacgaccgcatcgatgcgctgtcgggccgggcgttcaacctcggcggcggt
cccgccaatgcgatcagcttgcgacaggccctggcagagatcacccgcgtcaccggcgtg
acacccgaggtcgtctaccgggactggcggcagggcgatcagccctggtttgtcgccgac
accgccgctctgacagcggcgacaggctggcgggcgcggaccgactggcgccaaggcatc
gcgcgactggcgggctggctggccgaacaccgcgtccacccggaacccgaaaggatcctc
gcatga

DBGET integrated database retrieval system