KEGG   Confluentimicrobium sp. EMB200-NS6: TQ29_10710Help
Entry
TQ29_10710        CDS       T04096                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
con  Confluentimicrobium sp. EMB200-NS6
Pathway
con00471  D-Glutamine and D-glutamate metabolism
con01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:con00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    TQ29_10710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:con01011]
    TQ29_10710
Enzymes [BR:con01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     TQ29_10710
Peptidoglycan biosynthesis and degradation proteins [BR:con01011]
 Precursor biosynthesis
  Racemase
   TQ29_10710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ALG90574
UniProt: A0A0N9N377
Position
complement(2206779..2207591)
Genome map
AA seq 270 aa AA seqDB search
MAVGIFDSGLGGLTVLDVVAKRLPDVPFVYFGDNAHTPYGVRDADDVFNLTTAGVERLWA
AGCDLVILACNTASAVALKRMQETWLPDDKRVLGVFVPLIEALTERRWGDNSPPREVAVK
HVALFATPATVSSRAFQRELAFRAVGVDVEAQPCGGVVDAIEQGDEILAEALVRSHVEAL
LRRMPKPEAAILGCTHYPLMQAVFQDALGPDVTVYSQADLVAESLADYLERHPDMLGAGT
ETMFLTTGDPAKVSSKATQFLRHRIEFQAA
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcggttggtattttcgattctggtctgggcgggctgaccgttctggacgtggtggcc
aagcggctgcccgatgtgccctttgtctatttcggggataatgcgcatacgccctatggc
gtgcgcgacgccgacgacgtgttcaacctgaccaccgcgggggtcgagcggctgtgggcg
gcgggctgcgatcttgtgatcctggcgtgcaacaccgcctcggcggtggcgctgaaacgg
atgcaggaaacctggctgcccgatgacaagcgcgtgctgggcgttttcgtgcccctgatc
gaggcgctgaccgaaaggcgctggggcgacaattcccccccgcgcgaggttgcggtcaag
catgtggcgctgttcgcgacaccggccacagtttccagccgcgcgttccagcgcgagctg
gctttccgcgcggtcggtgtggatgtcgaggcgcagccctgcggcggcgttgtcgatgcg
atcgagcagggcgacgagattctggccgaggcactggtgcgcagccatgtcgaggcgctg
ctgcgccggatgccgaagcccgaggccgcgatactgggctgcacccattatccgctgatg
caggcggtgtttcaggatgcgctggggccggatgtcaccgtctattcgcaggccgacctg
gtggccgaaagcctggccgattacctggagcgccatcccgacatgctgggcgcgggcacg
gaaacgatgttcctgaccacgggcgatccggcgaaagtgtcgagcaaggccacacagttc
ctgcggcaccgcatcgaatttcaggccgcgtga

DBGET integrated database retrieval system