KEGG   Confluentimicrobium sp. EMB200-NS6: TQ29_15225Help
Entry
TQ29_15225        CDS       T04096                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
con  Confluentimicrobium sp. EMB200-NS6
Pathway
con00071  Fatty acid degradation
con00072  Synthesis and degradation of ketone bodies
con00280  Valine, leucine and isoleucine degradation
con00310  Lysine degradation
con00362  Benzoate degradation
con00380  Tryptophan metabolism
con00620  Pyruvate metabolism
con00630  Glyoxylate and dicarboxylate metabolism
con00640  Propanoate metabolism
con00650  Butanoate metabolism
con00900  Terpenoid backbone biosynthesis
con01100  Metabolic pathways
con01110  Biosynthesis of secondary metabolites
con01120  Microbial metabolism in diverse environments
con01130  Biosynthesis of antibiotics
con01200  Carbon metabolism
con01212  Fatty acid metabolism
con02020  Two-component system
Brite
KEGG Orthology (KO) [BR:con00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TQ29_15225
   00630 Glyoxylate and dicarboxylate metabolism
    TQ29_15225
   00640 Propanoate metabolism
    TQ29_15225
   00650 Butanoate metabolism
    TQ29_15225
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TQ29_15225
   00072 Synthesis and degradation of ketone bodies
    TQ29_15225
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TQ29_15225
   00310 Lysine degradation
    TQ29_15225
   00380 Tryptophan metabolism
    TQ29_15225
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TQ29_15225
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TQ29_15225
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TQ29_15225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:con04147]
    TQ29_15225
Enzymes [BR:con01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TQ29_15225
Exosome [BR:con04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TQ29_15225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt TUSC2
Motif
Other DBs
NCBI-ProteinID: ALG91300
UniProt: A0A0N9NV14
Position
3134346..3135521
Genome map
AA seq 391 aa AA seqDB search
MTNVVIVSAARTPVGSFNGAFANTPAQDLGTAVLEAIVARAGIEKSEVSETILGQVLTAG
QGQNPARQAHINAGLPIESAAWSINQVCGSGLRSVALAAQHIQLGDAAIVAAGGQENMTM
SPHVANLRAGHKMGDMKFIDSMIKDGLWDAFNGYHMGQTAENVAGQWQISRDMQDEFAVG
SQNKAEAAQKAGKFKDEIVPFTVKTRKGETVVSEDEYIRHGATLESMQKLRPAFTKDGSV
TAANASGINDGAAAVLLMSADDAEKRGLTPLARIASYATAGLDPSIMGVGPIFASRKALE
KAGWKADDLDLIEANEAFAAQACAVNKDMGWNPEIVNVNGGAIAIGHPIGASGCRILNTL
LFEMQRRDAKKGLATLCIGGGMGVAMCLERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgtagtgatcgtttcggccgcgcgtacgcctgtcggcagtttcaatggcgcc
ttcgcaaacacgccggcacaggatctcggcacggccgtgctcgaggccatcgttgcccgt
gccggcatcgagaaatccgaagtgtcggaaacgatcctgggccaggtgctcaccgccggc
cagggtcagaacccggcccgtcaggcgcatatcaacgccgggctgccgatcgaatcggcg
gcatggagcatcaaccaggtttgcggttcgggcctgcgcagcgtcgccctcgccgcccag
cacatccagcttggcgatgccgcgatcgtcgccgccggtggccaggaaaacatgacaatg
tcgccgcatgtggccaacctgcgcgccggccacaagatgggcgacatgaagttcatcgac
tcgatgatcaaggatggcctctgggacgcgttcaacggctatcacatgggccagaccgcc
gaaaacgtggccgggcagtggcagatcagccgcgacatgcaggatgaattcgccgtcggt
tcgcagaacaaggcggaggccgcgcagaaggccggcaagttcaaggatgaaatcgttccc
ttcaccgtgaaaacccgcaagggcgaaaccgtggtgtccgaggatgaatacatccgccat
ggcgccaccctcgaaagcatgcagaaactgcgccccgccttcaccaaggatggctcggtc
acagccgccaacgcctcgggcatcaacgacggcgccgccgccgtgctgctgatgagcgcg
gatgacgccgaaaagcgcgggctgacgccgctggcgcgcatcgcctcttatgccaccgcc
gggcttgacccgtcgatcatgggcgtcgggcctatcttcgcttcgcgcaaggcgctggaa
aaagccggctggaaggccgacgatctggacctgatcgaagccaacgaagccttcgccgcc
caggcctgcgccgtgaacaaggacatgggctggaaccccgagatcgtaaacgtgaacggc
ggcgccatcgccatcggccacccgatcggcgcctcgggctgccgcatcctgaacacgctg
ctgttcgagatgcagcgccgcgatgccaagaagggcctcgccacgctctgcatcggtggc
ggcatgggcgtagccatgtgtctggaacgcccgtaa

DBGET integrated database retrieval system