KEGG   Confluentimicrobium sp. EMB200-NS6: TQ29_19110
Entry
TQ29_19110        CDS       T04096                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
con  Confluentimicrobium sp. EMB200-NS6
Pathway
con00626  Naphthalene degradation
con01100  Metabolic pathways
con01120  Microbial metabolism in diverse environments
con01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:con00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    TQ29_19110
Enzymes [BR:con01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     TQ29_19110
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: ALG92322
UniProt: A0A0N9NVG2
Position
pNS6002:complement(99527..100522)
AA seq 331 aa
MKHELLTVDDVTGCWAIMPTPSKPNASDPRAEDTVDLDETARVVEALIASGVNGILSLGT
LGEGATTTWQEKQAFMRTLVEAGRGRIPIFGGATALNTRDSISMTRAAREIGLNGVMMGP
PMWVQPDVPTAVQFFRDVAEACPDMAICAYANPEAFKFEFPRAFWAQISEIPQIVSAKYI
NTAALYTDLNLTKRRIRLMPLDVDYYAAARLDPEHCTAFWTSGAVCGPAPVIQLRDLVAK
AVETGDWTQAKKLTDRIGLTYRTLFPNGSFKEFSVYNIGIEKARMDAAGWMVAGPCRPPY
HLVPATALEGARESGRQWAKLAAELEAESGK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgaaacatgaactgctcacggtcgatgacgtgacaggttgctgggcgatcatgcccacg
ccgtccaagcccaacgcgtcggatccgcgcgctgaagacacggtcgatctggacgaaacg
gcccgtgtcgtcgaggctctgatcgcctctggtgtgaacgggattctttctctcggcacc
ctgggagagggagccacgacaacatggcaagagaagcaagccttcatgcgcacgctggtc
gaagccggtcgcggtcgcattcccatcttcggcggggcgaccgcccttaacacccgcgac
tccatcagcatgacccgtgccgcgcgcgagatcgggcttaacggggtgatgatggggccg
ccgatgtgggttcagcctgatgtgccgacagcagttcagttctttcgtgatgtggccgag
gcgtgcccggacatggctatctgtgcatatgccaaccccgaggcattcaagttcgagttc
ccgcgtgctttctgggcgcagatctccgaaattccgcagatcgtatctgccaagtacata
aacacggcagcgctctatacggacctgaacctgaccaagcgccgcattcgactgatgccg
cttgatgtggactattacgccgccgcccggctcgaccccgaacactgcacggcgttctgg
accagtggcgcggtttgcgggccagcacctgtgatccagcttcgcgaccttgtggccaag
gcggtagagactggcgattggacccaagccaaaaaactgaccgacaggattggtttgacc
tatcggaccctcttccccaacggctcgttcaaggaattctcggtctataacatcggcatc
gagaaggcccgtatggatgcggcaggttggatggtcgctggaccttgccgtccgccctac
cacctggttcccgcaacggctctggaaggcgcgcgcgagtccgggcgtcaatgggcaaaa
ctcgctgcggagcttgaggcggagagcggcaagtga

DBGET integrated database retrieval system