KEGG   Confluentimicrobium sp. EMB200-NS6: TQ29_19180
Entry
TQ29_19180        CDS       T04096                                 

Definition
(GenBank) 3-phenylpropionate dioxygenase
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
con  Confluentimicrobium sp. EMB200-NS6
Pathway
con00621  Dioxin degradation
con01100  Metabolic pathways
con01120  Microbial metabolism in diverse environments
con01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:con00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    TQ29_19180
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: ALG92381
UniProt: A0A0N9NZY4
Position
pNS6002:114186..114458
AA seq 90 aa
MPEGDMKVFEGGPEPIMVCRVDGEIHAVQDTCTHDTWSLADGFIEDGVVECSLHFAKFCV
RTGKVKALPACEALKVFPAKVDGDFIYIDC
NT seq 273 nt   +upstreamnt  +downstreamnt
gtgccggagggggatatgaaagtattcgaaggtggccctgagccgataatggtgtgccgg
gtggacggcgaaatacacgccgtccaggacacctgtacgcatgacacgtggtcactcgcg
gacggttttatcgaggacggagttgtcgagtgcagtctgcacttcgcgaaattttgcgtc
agaaccggcaaggtgaaggccctgcctgcttgtgaggcactcaaggtgttccccgcaaag
gttgacggcgacttcatatacatcgactgctga

DBGET integrated database retrieval system