KEGG   Coprococcus sp. ART55/1: CCU_08830Help
Entry
CCU_08830         CDS       T02583                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
coo  Coprococcus sp. ART55/1
Pathway
coo00052  Galactose metabolism
coo00561  Glycerolipid metabolism
coo00600  Sphingolipid metabolism
coo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CCU_08830
  Lipid metabolism
   00561 Glycerolipid metabolism
    CCU_08830
   00600 Sphingolipid metabolism
    CCU_08830
Enzymes [BR:coo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CCU_08830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2
Motif
Other DBs
NCBI-ProteinID: CBK82630
UniProt: D5HIM5
Position
893681..896170
Genome map
AA seq 829 aa AA seqDB search
MIRYIEEHQVFILETKSTQYAMCVRPDGHLEHLYYGGRSLDCGDQNIVGLWDVAHDRSLF
ETGNAIALDGGLTLESLLQELSSTGKGDVSEPFVCMTHANGSTTCDFVYESYEIKNGRDE
LEGLPCAVEYHRGTDGRFNTVNEQQGTEVGSGVAGGLQSIQAYERQNTAGEVTQLTITLR
DKFYRQKLELIYVTWDDCDVITRSARLTNESDDVERVDRLMSMQFDMRMYQEYDMIHFGG
AWAREMHRSVHPVRQGRVSVSSSTGTSGSRANPFFMVVEHGSSEEHGECYGFNLIYSGDH
MESCEQNSYGRMRILSGINPEGFSFALEPGQSFQSPEAVMTYSDSGFGGVSSHMHAFVRR
HIVRGHWADRERPVLLNSWEAAYFDINEKKLLKLAKEAKKCGIELFVMDDGWFGHRDNDT
SSLGDWQENRSKLPGGVKQLADKINALGLDFGIWVEPEMVNEDSDLYRAHPEWAVRVPGQ
SHAEGRHQMILDLTNKDVRDHIVEAMTNVFSSANISYVKWDMNRIMSDRYSQTLPPDRQS
EFGHRYVLGLYDIMGRLTERFPEILFEGCAAGGNRFDLGILCYMPQIWASDDTDARERLE
IQTGYSYGYPMSVVSSHVSGCPNHQTLRVTPLETRFGVAAFGVLGYECNLCDMRKKDLEA
IEEQVEFYKRHRRTFQFGEYHRIENGTVSDLRRNVYQFMTVSQDGSEAVSCYYEGQVIPN
YTYKHMRTKGLDENAVYVMEGRSLQYSVKLMGDLINTVTPVHVKPDSLTQSAIDKVVKLQ
GEKEYVKASGAVFNRVGVNLAPNFAGTGYNDQTALWTEHGLRLYTFTRQ
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgatcagatatatagaagaacatcaggtattcatactggagacaaagtcgacgcagtat
gccatgtgcgtgcgcccggatggacaccttgagcacctgtactacggtggcaggagtctg
gactgcggagatcagaatattgtgggactttgggatgtggcacatgaccgcagcctgttc
gagaccggcaatgccatagcgctggatggtggacttaccttagaaagtctgctacaggaa
ctgtcgtcaaccggcaagggggatgtcagcgaaccatttgtctgtatgacccatgcaaat
ggcagtacgacctgcgactttgtgtacgaatcatacgagataaaaaacggcagggatgag
cttgaaggacttccgtgtgcggtggaatatcatagggggacagatggcagattcaacaca
gtaaatgagcagcaaggcacagaagtgggaagcggtgtggctggtggattgcagagcata
caagcatatgagcgacagaatacagcgggcgaggtaacacagctcaccataaccctccgg
gacaaattctacagacagaagcttgagctaatatatgtcacatgggatgactgcgacgtg
ataaccagaagtgcccgcctgacaaatgaaagcgatgacgtggagcgggtggacagactt
atgtccatgcagtttgatatgagaatgtatcaggaatatgacatgatacatttcggagga
gcctgggcgagggaaatgcacagatcagtgcaccctgtaaggcagggaagagtgtctgtc
tcatcgtcgaccggaacctcgggcagcagggccaatccgttcttcatggtggttgagcac
ggcagttcagaggaacacggtgagtgttacggcttcaatctcatatattcaggagaccat
atggagagctgtgaacagaattcatatggacgtatgcgtatactcagcggcatcaatccg
gaaggattttcatttgcgcttgagccgggacagtcattccagtcgccggaggcggtcatg
acatattcagattcaggatttggcggtgtcagcagtcatatgcatgcatttgtcagaaga
catatagtcagaggccactgggcggaccgggagaggcctgttctgctgaatagctgggag
gccgcatactttgatataaatgagaagaagctgctgaagcttgcaaaagaggcaaagaag
tgcggcatagagctgttcgtcatggatgacggctggttcggacacagggacaatgacaca
tcctcacttggagactggcaggagaaccgcagcaagcttccgggcggagtgaagcagctt
gcggacaagataaatgcacttggacttgactttggcatatgggtagagccggagatggtg
aacgaggacagtgatctctacagggcacacccagagtgggcggtcagagtgccgggacag
agccatgccgaggggcgtcatcagatgattctggatctcaccaataaggatgtgagagac
catatagtggaagccatgacaaatgtgttctcatctgccaatatatcgtatgttaagtgg
gatatgaacaggattatgtctgaccgctacagtcagacgctgccgcctgacaggcagagt
gaatttggacacagatatgtgcttggactctacgacatcatgggaagactcacggagcgt
ttccctgagatattgtttgagggatgtgccgccgggggaaacagattcgatctcggcata
ctgtgctatatgccgcagatatgggcaagtgatgacacggatgccagggagaggcttgag
atacagacgggatacagctatggttatcctatgtcggtagtcagcagtcacgtgtccgga
tgcccgaatcaccagacactcagagtcaccccgcttgagacgagattcggagtggcggca
tttggcgtgctgggctatgagtgcaatctgtgcgatatgaggaagaaagatctggaggca
atagaagagcaggtggagttctacaagagacacaggcgcacatttcagttcggcgaatat
cacaggatcgagaatggcacagtgtcagatctccggaggaatgtgtaccagttcatgacg
gtttcccaggatggctccgaggcggtgtcctgttattatgaggggcaggtgataccgaat
tacacttacaagcatatgcggactaagggacttgacgagaatgcagtttatgtcatggag
ggcagaagcctgcagtacagcgtaaagctcatgggagatctcatcaacactgttacgccg
gtgcatgtgaaacctgattccctgacccagagtgcgatagacaaggtggtaaagcttcag
ggcgagaaggaatatgtaaaggcgtccggtgcagtgtttaaccgcgttggagtgaacctt
gctccgaactttgcgggaactggctacaacgaccagaccgctctctggacagagcatgga
ctgaggttatataccttcaccagacagtga

DBGET integrated database retrieval system