KEGG   Coprococcus sp. ART55/1: CCU_25690Help
Entry
CCU_25690         CDS       T02583                                 

Definition
(GenBank) Formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
coo  Coprococcus sp. ART55/1
Pathway
coo00670  One carbon pool by folate
coo01100  Metabolic pathways
coo01120  Microbial metabolism in diverse environments
coo01200  Carbon metabolism
Module
coo_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:coo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CCU_25690
Enzymes [BR:coo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     CCU_25690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: CBK83885
UniProt: D5HG52
Position
2726880..2728550
Genome map
AA seq 556 aa AA seqDB search
MMTDIEIAQKAEMKHIREVAAKLGISEDDLDLYGKYKAKLSDELIKKVEGNENGKLILVT
AINPTPAGEGKTTITVGLGEAMGQLGKKAVIALREPSLGPCFGIKGGAAGGGYAQVVPME
DLNLHFTGDFHAITSANNLLAAMMDNHIHQGNALRIDVNRIVFKRCMDMNDRVLRHTVVG
LGKRVDGVPREDGFVITVASEIMAILCLASDMKDLQERLGRIIVAYNMDNEPVTAADLKA
VGAMAALLKDAIKPNLIQTLEHTPAIVHGGPFANIAHGCNSVMATKTALKLADYVITEAG
FGADLGAEKFFDIKCRMNNLKPDAVVLVATVRALKYNGGVAKADLGEENLDALKAGIVNL
EKHIENLQKYGVPVVVTLNRFVTDSQAELDFVKKFCEDRDCDFALANVWEQGGKGGIDLA
NAVLNTLENKKSNFKVLYDDSLSIKDKIDCIATEIYGADGVTYSAEASKAIAKIEEMGFG
NFPVCMAKNQYSLSDDPKKLGRPTGFDINIREVYVSAGAGFVVAITGTIMTMPGLPKSPA
AERIYVDDDGKIVGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagacattgaaattgcacagaaggctgagatgaagcacataagggaggttgct
gcaaagctcggaatatcagaggatgacctcgatctctatggaaagtataaggcaaagctc
tcagatgagcttataaagaaggttgagggcaacgagaacggaaagcttatcctcgttaca
gccatcaatccaacacctgcaggagagggaaagacgacaatcactgtaggacttggtgag
gctatgggacagcttggaaagaaggcggttatcgcacttcgtgagccatcacttggacca
tgttttggaatcaagggtggtgcagccggcggcggatatgcacaggtagtacctatggag
gatctcaacctccactttacaggagattttcatgctataacatctgcaaacaatctcctt
gcagccatgatggataaccatatccatcagggaaatgcactgagaatagatgtgaacaga
atagtgttcaagagatgtatggatatgaacgacagagttctcagacacacagttgtcgga
cttggaaagcgtgtcgatggagtgcctagagaggacggatttgtcatcacagttgcatcg
gagatcatggctattctctgtcttgcaagtgacatgaaggatcttcaggagagacttggc
agaataatcgttgcatacaacatggacaatgagcctgtgacagcggctgatctcaaggct
gtaggagctatggcagcgctcttaaaggatgccatcaagccaaaccttatccagacactt
gagcatacaccggcaatcgtacacggcggaccatttgcaaatatagcacatggatgtaac
agtgtaatggctacaaagacagcattaaagcttgcagattatgtaataacagaggcagga
tttggcgcagatctcggagctgagaagttcttcgatatcaagtgccgtatgaacaacctt
aagccggatgcggtggttctggttgctacagtaagagccctcaagtacaatggcggagtt
gcaaaggcagatctcggcgaggagaatctcgacgcgcttaaggctggtatagtaaacctt
gagaagcatattgagaatcttcagaagtatggcgttcctgttgttgtaactttgaataga
tttgtcacagacagtcaggcagagcttgactttgtcaagaagttctgcgaggacagagat
tgcgattttgcccttgcaaatgtatgggagcagggaggcaagggtggtatagaccttgca
aatgcagtgctcaacacgctggagaacaagaagagcaacttcaaggtgctctacgatgac
agcctgtcaataaaggataagatagattgtatcgctacagagatatatggtgcggatggt
gttacatacagcgcagaggccagcaaggccatcgccaagatcgaggagatgggatttggt
aacttccctgtatgtatggcaaagaaccagtattctttgtcagatgatccaaagaagctt
ggaagacctacaggattcgatataaatatccgtgaggtttatgtcagtgcaggagcagga
tttgtggtagcgattaccggaactatcatgaccatgcctggacttccaaaatccccggcg
gcagaaaggatttatgttgatgatgacggcaagatcgtcggattattctag

DBGET integrated database retrieval system