KEGG   Corynebacterium pseudotuberculosis 31: Cp31_1698Help
Entry
Cp31_1698         CDS       T02029                                 

Gene name
cat1
Definition
(GenBank) Succinyl-CoA Coenzyme A transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
cop00020  Citrate cycle (TCA cycle)
cop00620  Pyruvate metabolism
cop00650  Butanoate metabolism
cop01100  Metabolic pathways
cop01110  Biosynthesis of secondary metabolites
cop01120  Microbial metabolism in diverse environments
cop01130  Biosynthesis of antibiotics
cop01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cop00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Cp31_1698 (cat1)
   00620 Pyruvate metabolism
    Cp31_1698 (cat1)
   00650 Butanoate metabolism
    Cp31_1698 (cat1)
Enzymes [BR:cop01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     Cp31_1698 (cat1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans
Motif
Other DBs
NCBI-ProteinID: AFH91500
Position
complement(1933617..1935122)
Genome map
AA seq 501 aa AA seqDB search
MSDRIANAQLRGKIMSAQEAAQLVDNGDKVGVSGFTGAGYPKVMPAAIAERAKEAQAKGE
SYTIDLFTGASTAPDCDGVLAEAGALRFRMPYQSDPSMRKAINSGNMLYSDIHLSHSGAM
VAEGFFGQLNVAIVEAVRIKEDGSIVPSSSVGNSVEYLDAAEKIIIEVNSWQSEELEGMH
DIWRMPRTPNRIAIPIKNTGDRIGDTSISIDINKVVAVVETDAPDRNAPFKPLDDVSREI
ASNFLGFLEGEVKAGRLDYDRYIMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMVD
LIDAGKMIVASATSFSLSPEYADKMNENAEFYRKHIVLRPQQISNHPEVIRRTGLIASNG
MIEADIYGNVNSTHVNGVRMMNGIGGSGDFTRNALISTFISPSVAKDGAISAIVPFASHI
DHTEHDVMVLITEYGVADLRGLAPRERVQKAISVAHPDYRPLLEEYFEAAKKATPFMQTP
HDLTQAFSFHHRMNETGTMAK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcgcattgctaacgcacagttgcggggcaaaattatgtcggcacaagaggcc
gctcagctcgtagataacggtgacaaagtcggtgtctcgggcttcacgggtgccggctac
ccaaaggttatgcctgctgcgatcgccgagcgagcaaaggaagcacaggctaaaggggaa
agctacaccattgacctctttaccggcgcttccaccgcaccggactgcgatggcgtgtta
gcagaagccggagctttgcgtttccgaatgccatatcagtcagaccccagcatgcgtaag
gccattaactcgggcaacatgctgtactccgatatccacctgtctcattcgggcgcgatg
gtagcggaaggcttctttggtcagctgaacgtggctattgttgaggccgttcgtattaaa
gaagacggatcgattgtgccgtcttcctccgtaggaaattccgtggaataccttgatgcg
gcagagaagatcatcatcgaggtcaactcgtggcagtccgaggaacttgagggaatgcac
gacatttggaggatgccgcgtacccccaaccggattgctatccctattaagaacaccggt
gatcgcatcggtgatacctcgatttctattgacatcaacaaggtagtagcagtcgttgag
actgatgctcctgaccgcaacgctccttttaagcctctcgacgacgtctcccgcgagata
gcctcgaacttcttgggcttcctcgaaggggaagttaaagctggtcgactcgactatgat
cgctacatcatgcagtccggcgtaggtaacgttcccaatgccgtgatggcaggcctattg
gactccaagtttgaaaatatccaggcctacaccgaggtcatccaagacggcatggtcgac
ctgatcgatgccggcaagatgatcgttgcttctgccacttcattttcgctgtccccggag
tatgcggacaagatgaatgagaacgcagagttctaccgcaagcacatcgttctgcgtcct
cagcagatctccaaccatcctgaggtgatccgtcgcaccgggttgatcgcttccaacggc
atgatcgaggctgacatttacggcaacgtgaactccacacacgttaatggtgtgcgcatg
atgaacggcatcggaggatccggtgactttacccgtaacgctttgatctccaccttcata
tctccatcggtggctaaggatggcgctatctccgctatcgttccattcgcatctcatatc
gaccacacggagcacgacgtcatggtgctcattacggaatacggtgttgcagacttgcgc
gggcttgcaccacgagagcgtgtgcagaaggccatctccgttgcccacccggattaccgt
cctttgctggaggaatactttgaggcagcaaagaaggcaacgcctttcatgcagaccccg
catgacctcactcaggctttctcattccaccaccgcatgaatgagaccggaacaatggct
aagtaa

DBGET integrated database retrieval system