KEGG   Corynebacterium pseudotuberculosis 31: Cp31_1985Help
Entry
Cp31_1985         CDS       T02029                                 

Gene name
deoA
Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
cop00240  Pyrimidine metabolism
cop01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cop00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cp31_1985 (deoA)
Enzymes [BR:cop01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Cp31_1985 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N TMP_2
Motif
Other DBs
NCBI-ProteinID: AFH91781
Position
2268582..2269868
Genome map
AA seq 428 aa AA seqDB search
MAEKFDAVDVIRTKRDNGKLSKGQIDWIIDAYTRGIVGDDQMAALNMAIFLNGMDREEIV
QWTQAMIDSGETMSFASLSRPTTDKHSTGGVGDKITLPLAPLVASYGVAVPQLSGRGLGH
TGGTLDKLEAIPGWEADIDNARMMKILEDPGCVVCAAGAGLAPADKKIYALRDITATVDC
IPLIASSIMSKKIAEGTANLVLDVKVGSGAFMKELDQARELARTMVDLGRDAGTNMVALL
TDMSVPLGRTIGNALEVRESVEVLAGGGPSDVIELTCALATEMLELAGVHDPDVHEALAD
GRAMDSWKKMIRAQGGDPDAALPTARHTHEVTADRDGYLTEMDALALGVASWRLGAGRAR
KEDPVQLGAGIEIHAELGEKVSKGQKLFTLHTDDEDRFSRALESLEPGVNIGDEPPAPRP
SVVLDRIS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagaaattcgacgccgtagacgtcatccgcacaaagcgggacaacgggaagcta
agcaagggacaaatcgactggatcatcgacgcctacactcgcggcattgttggcgacgat
caaatggctgccctcaacatggcaatattcctcaacggcatggacagagaagaaatcgtc
cagtggacccaggccatgatcgactccggcgagaccatgagctttgccagcctctcccgg
ccaacaacagacaagcactccaccggcggggtcggcgataaaatcacgcttccacttgcg
ccactcgttgccagttacggcgttgccgtgccacaactctctggtagaggactaggacac
acaggcggaaccctagacaaattagaggccatccccgggtgggaagctgacatagataat
gcccgaatgatgaagatcctcgaagaccccggctgcgtggtatgcgccgcgggagcaggc
ctcgcacccgccgacaagaagatctatgcgctgcgtgacatcactgccaccgtcgactgc
atcccgctgatcgccagctccatcatgagtaaaaaaatcgccgagggaaccgcaaaccta
gtcctcgacgtcaaggtgggttccggggcctttatgaaggagcttgaccaggcccgcgag
ctcgcccgcaccatggttgacctaggccgcgacgccggaaccaatatggtcgcgcttctc
accgacatgtccgtccccctggggcgcaccatcggcaatgccctagaagttcgcgagtct
gtagaagtcctcgcaggcggtggcccttccgacgtcatagagctcacctgcgcccttgcg
acggagatgcttgagctcgccggcgtccatgaccccgatgtccacgaagcgcttgccgac
ggccgcgcgatggactcttggaagaagatgatccgcgcgcagggcggcgaccccgacgca
gcgctccccaccgcacggcacacccatgaggtcaccgccgatcgcgacggctatctcaca
gagatggacgccctcgcactgggagtagccagctggcgactcggcgcaggacgcgcacgc
aaggaagatccagtccaactcggcgcaggcatcgagatccatgcagagctcggcgagaag
gtttcaaagggccagaagcttttcaccctccacaccgacgatgaggaccgtttcagccga
gccctagaatccctcgaacccggcgtaaatatcggcgatgagcccccggcacctcgcccc
tcggtcgtccttgatcgcatcagctaa

DBGET integrated database retrieval system