KEGG   Corynebacterium pseudotuberculosis 31: Cp31_2060Help
Entry
Cp31_2060         CDS       T02029                                 

Gene name
nanK
Definition
(GenBank) N-acetylglucosamine kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
cop00010  Glycolysis / Gluconeogenesis
cop00052  Galactose metabolism
cop00500  Starch and sucrose metabolism
cop00520  Amino sugar and nucleotide sugar metabolism
cop00521  Streptomycin biosynthesis
cop01100  Metabolic pathways
cop01110  Biosynthesis of secondary metabolites
cop01120  Microbial metabolism in diverse environments
cop01130  Biosynthesis of antibiotics
cop01200  Carbon metabolism
Module
cop_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cop00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp31_2060 (nanK)
   00052 Galactose metabolism
    Cp31_2060 (nanK)
   00500 Starch and sucrose metabolism
    Cp31_2060 (nanK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp31_2060 (nanK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cp31_2060 (nanK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Cp31_2060 (nanK)
Enzymes [BR:cop01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cp31_2060 (nanK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK DUF320
Motif
Other DBs
NCBI-ProteinID: AFH91856
Position
complement(2349494..2350429)
Genome map
AA seq 311 aa AA seqDB search
MISAGNKVQTPVRIGVDIGGTKIAAGLVADANPTTVIEYRRRPTPASNVIQEVAGVIQEL
IDVSPTAVSSIGIGAPGVIDPIEGNVVSSGPTMQGWAGTKIADTLREQFPVPVAVHNDVR
VMGLGESIYGAGQDFNNILFVSLGTGVGGALVRDGGLVASPHCTAGELRCLWGRLPDGSA
ALLESFASGPGLAASYNAHAENPAVDLHEIMTRYHAGEEYARGVIEEHLFACGVAIGGFI
SAIDVDAVVVGGGVGNIGDAIINPFARGLKEGAIPPLDAVPVIQAQLGTDAPIVGAAYLG
KTQDQINKVSI
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgattagcgcaggcaataaagtgcaaacccccgtgcgcatcggcgtggatattggtgga
accaagatcgcggcgggcctggtggcggatgctaaccccaccaccgttattgagtatcgt
cgtcggcctacccccgcgagcaacgtgatacaagaggtcgctggcgttatccaagagctt
atagacgtctcccctactgcggtttcgagcataggaatcggtgctccaggggtcattgat
cccatagaaggcaacgtagtgtcctcggggccgaccatgcagggatgggcgggaactaag
atcgcggatacgctgagggaacaattcccggttcccgttgccgtgcataacgacgtccgc
gttatggggctgggcgagtccatctatggcgctggtcaggactttaacaatattcttttt
gtcagcctgggcactggcgtgggcggggcacttgtgcgtgatggtgggcttgttgcctcg
cctcactgtaccgctggagagctgcgttgcctgtggggacggctccccgatggatctgct
gccctcttagagtccttcgcctctggtcctggactcgctgcctcctataacgcgcatgcg
gagaacccagccgtggatctccacgagattatgactcgataccacgcgggtgaagaatat
gcgcggggtgttattgaggaacatctctttgcctgcggggttgctatcggcgggtttatt
agtgccattgacgtggatgctgtggtggtcggcggtggcgtgggcaatattggcgatgcc
attattaacccctttgctcgtgggctaaaagaaggcgccatccctccactcgatgcagta
ccagttatccaggcacagctaggaaccgatgctcccatcgtgggagccgcatatctgggg
aagacccaagaccaaatcaacaaagtatctatttaa

DBGET integrated database retrieval system