KEGG   Corynebacterium pseudotuberculosis 31: Cp31_2087Help
Entry
Cp31_2087         CDS       T02029                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cop  Corynebacterium pseudotuberculosis 31
Pathway
cop00260  Glycine, serine and threonine metabolism
cop00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cop01100  Metabolic pathways
cop01110  Biosynthesis of secondary metabolites
cop01130  Biosynthesis of antibiotics
cop01230  Biosynthesis of amino acids
Module
cop_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cop00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp31_2087 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp31_2087 (trpA)
Enzymes [BR:cop01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cp31_2087 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG NanE Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: AFH91883
Position
2378358..2379197
Genome map
AA seq 279 aa AA seqDB search
MNRYHNLFTRLEQSNEGAFVPFIMLGDPSPEASLSIIRTAVSAGADALELGIPFSDPVAD
GPTIQRSHLRALDNGATVDSSLKLISHIRSEFPELPIGLLIYGNVPFTRGLDSFYQEFAA
AGADSILLPDVPVREGGAFIAAAQRARIAPIFIAPAQASEETLHAVATHSEGYIYAISRD
GVTGTERESSTSGLTDVVNNINKFGGAPVLLGFGISTPQHVREAIDAGARGVITGSAITA
IIERHCIGQHPAPATIDDMSALQSEIFAFISEMKAATRR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttaccacaatctttttacccggctagaacaatccaatgagggcgcctttgtt
ccctttatcatgcttggagaccccagccctgaagcatcattatcaatcatccgtaccgcc
gtcagtgccggcgcagacgcccttgagcttgggatcccattctcagacccagtagctgac
gggcctaccattcagcgttctcatctccgcgccctggataatggggcaacggttgattcc
tcattaaagctcatctctcacattcgttcagaattccccgaactacccatcggcctcttg
atttatggcaacgttccttttacccgtggactagatagcttctatcaagaatttgccgca
gccggcgccgattccattttgcttcccgacgttcccgtgagggaggggggagccttcatc
gcagcggcacagagagcgagaatcgcacccattttcatcgccccggcacaggcttctgaa
gagaccctccatgcagtagcaacacattccgagggatacatctatgcaatttctcgtgat
ggagttaccggaacggaacgagaatcttccaccagtggtctcaccgatgtggtaaacaac
atcaataaattcggcggagcgccggtacttctagggttcggaatttccacgcctcagcat
gtccgtgaagcgatagatgccggcgccaggggagtaatcactggatccgcaatcactgcg
attattgaaagacactgcatcggccaacatcctgcacccgcaacaatcgatgacatgtct
gcactgcaatcggagattttcgctttcatctcagaaatgaaagcggcgacccgcagataa

DBGET integrated database retrieval system