KEGG   Commensalibacter sp. AMU001: D9V35_02905Help
Entry
D9V35_02905       CDS       T05684                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
coq  Commensalibacter sp. AMU001
Pathway
coq00561  Glycerolipid metabolism
coq00640  Propanoate metabolism
coq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:coq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    D9V35_02905
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    D9V35_02905
Enzymes [BR:coq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     D9V35_02905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase PFK
Motif
Other DBs
NCBI-ProteinID: AYN86517
Position
622497..623615
Genome map
AA seq 372 aa AA seqDB search
MLTIIQSPSKYIQGAGALEKVGKYALMLANSYLVVADSFVMNLTQATLEKSFQISSVQAY
FEIFRGECCKKEINRLGEILKRHGCKGVVGVGGGKALDTAKAIAFYNKVPVIIVPTAASN
DAPTSALSVIYTEDGAFEEYLMYPSNPDMVIMDSTIVANAPLRLLISGMGDALSTYFEAR
ACYEARAVSMAGGQSTLAALNLARLCYETLLEEGLKAKAAVEAGVAIKAVDNIIEANTYL
SGIGFESSGLAGAHAIHNGLTVLEECHSMLHGEKVAFGTLAQLVLENAKQEELETVLDFC
VQIGLPVTLDQIGIQDNDDLKGKIMKVAKASCAKDDTIHNMPFEVSEDQVYAAIMAADRI
GHKWLKNYNIVL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgattattcaatctccgtcaaaatatatccaaggtgctggtgcacttgaaaaa
gttggtaaatatgccttgatgctggccaatagttatttggttgtcgctgatagttttgta
atgaatttgacacaagccacattggaaaaaagtttccagatttcctcggtgcaggcatat
tttgaaatttttaggggagagtgttgtaaaaaagagattaatcgtttaggtgaaattcta
aagagacacggttgcaaaggggttgtcggtgttggtggcgggaaagcccttgatacagcg
aaagccattgcgttttataataaggttccggttataattgtgccgacagctgcatcgaat
gatgcgccaaccagcgctttatctgtaatttataccgaagatggcgcttttgaggaatat
ttgatgtatccttccaatcctgatatggtaattatggatagcacaattgttgccaatgca
ccccttcgtttattgatttcaggaatgggagatgcattatctacctattttgaagccaga
gcctgttatgaggcaagagctgtctccatggcaggggggcaatcaacattggcagccttg
aatttggccaggttatgttatgaaaccttgttggaagaagggttgaaggcgaaagcggct
gtcgaggctggagttgctataaaagctgtcgacaacattatcgaggcgaatacgtattta
agtggcatcggatttgaaagttctggcttggcaggggcacatgcaatccataatggatta
accgttcttgaagaatgtcattccatgttacacggtgaaaaagttgcattcggcacttta
gctcagcttgtacttgaaaatgcgaaacaggaagaattggaaaccgttcttgatttttgt
gtacaaataggtttaccggttactcttgaccaaattggtatacaggataatgatgatctt
aagggaaaaataatgaaagtggcaaaggcaagttgtgcaaaagatgacactatacacaac
atgcctttcgaagtttctgaagatcaggtttatgccgctattatggctgctgatagaatt
ggtcataaatggttaaaaaactataatattgttttgtag

DBGET integrated database retrieval system