KEGG   Commensalibacter sp. AMU001: D9V35_05970Help
Entry
D9V35_05970       CDS       T05684                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
coq  Commensalibacter sp. AMU001
Pathway
coq00270  Cysteine and methionine metabolism
coq00480  Glutathione metabolism
coq01100  Metabolic pathways
Module
coq_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:coq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    D9V35_05970
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D9V35_05970
Enzymes [BR:coq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     D9V35_05970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST ATPgrasp_TupA ATP-grasp_3 GSP_synth ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AYN87073
Position
complement(1310915..1311874)
Genome map
AA seq 319 aa AA seqDB search
MLKIAVQMDPLEKINIHGDSTFALMLEAQARGYSLFVYSVNSLSLFNNEKSKYVTARGRK
VNIQKVTGDHVKFGEVETVNLADFDVLLMRQDPPFDMGYITATHILERIHGVGKDKVFVV
NNPKSVRNSPEKLMATFWPELMPPTLVSRDVETIRMFREEYKDIVVKPLFGNGGVGVFRI
QDEDENFNALLEMQFSISNEPLMVQRYEPSVKRGDKRIILVDGEPIGAINRVPQKGDMRS
NMHIGGVAEKTQLTERDLYICSKIGKTLKEQGLIFVGIDVLGDYLTEINVTSPTGLQELD
RFNQMNSAACIWNVIESYL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaatcgcggtacaaatggatcctttggaaaagataaatattcatggagattca
acatttgcattgatgctcgaggcacaggctcgtggttattcactttttgtttattctgta
aatagcttaagtttgttcaacaatgaaaaaagtaagtatgtaacagcacgaggtcgaaaa
gttaatattcaaaaggttacaggtgatcatgtaaaatttggagaagtggaaaccgtgaat
ctggcagattttgacgtgctgttgatgcgccaggatccaccttttgatatgggatatatt
actgccacacatattctggaacgtattcatggtgtgggcaaggacaaggtatttgttgta
aataatccaaaatccgttcgaaattcacctgaaaaattaatggctacattttggcctgaa
ttaatgcctcccacgcttgtttcccgcgatgtcgaaacaattcggatgtttagggaggaa
tacaaagatattgttgttaaaccgttgttcgggaatgggggtgtaggcgtttttcgcatt
caggatgaggatgagaattttaatgcattgttagaaatgcagttttcaatatccaatgaa
cccctgatggtgcaacgttacgagccttccgttaagaggggagacaaaaggatcatttta
gttgatggggaacctatcggtgcaatcaatcgagttccgcaaaaaggagatatgcgatcc
aatatgcatattgggggagtggcggagaaaactcaattaactgaacgggatctttatatt
tgctctaaaataggtaaaaccctgaaagagcaggggttgatttttgttgggatagatgta
ttgggggattaccttactgaaattaatgtcacctcaccaacagggttacaagagctggac
cgttttaatcaaatgaattctgccgcttgtatctggaatgttattgaatcctatctataa

DBGET integrated database retrieval system