KEGG   Corynebacterium pseudotuberculosis 267: Cp267_1351Help
Entry
Cp267_1351        CDS       T01934                                 

Definition
(GenBank) Mycothione/glutathione reductase
  KO
K17883  mycothione reductase [EC:1.8.1.15]
Organism
cor  Corynebacterium pseudotuberculosis 267
Brite
KEGG Orthology (KO) [BR:cor00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Cp267_1351
Enzymes [BR:cor01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.15  mycothione reductase
     Cp267_1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 AlaDh_PNT_C 3HCDH_N 2-Hacid_dh_C Shikimate_DH UDPG_MGDP_dh_N K_oxygenase XdhC_C NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AFH52249
Position
1415618..1417009
Genome map
AA seq 463 aa AA seqDB search
MSEQAHKHYDLIIIGTGSGNSIPGPEFHDKSIAIVEKGAFGGTCLNVGCIPTKMFVYASE
IALAVRESERYGISAEVSAVDWPSIVNRVFRDRIDPISASGEEYRRGPKTPNIDVYDQHA
SFVAPKTIRTGQGDKEAIISGDRIVIATGSRPFIDQKVIDSGVHYYTNETIMRLESLPTS
MVVMGGGYIAMEFAHVFDALGVKVTVVNRSQKLLRQLDSDISDRFTEITKEKLDCRLGRT
IQSITENDGTVTLTLDDGSTAEGEVFLVATGRIPNGDLMDLDNAGVEMDGRRIKVDQYGR
TTAPDVWALGDVSSPYLLKHVANAEMRAVKHNLLHPEDLQSMPHENVPAAVFTHPQIGTV
GLTEDEARAAGYNITVKIQNYGDVAYGWAMEDTEHFVKLIADKDTGLLLGAHFIGPQAST
LVQQLITVMAFKLDVRDVATKQYWIHPALPELTENALLGLDFS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgagcaggcccacaaacactacgatttgatcattattggcacaggatccggaaat
tctattccgggccctgagtttcacgataagtccattgcaatagtagaaaagggagccttc
ggcgggacatgcctcaacgttggttgcatcccaacaaaaatgtttgtgtacgcctctgaa
atcgctttagcagtacgagagtctgaacgctacggcatttcagccgaggtttccgccgtg
gattggccgtctattgtcaatcgggttttccgtgaccgtatcgatcccatttccgcttct
ggtgaagaatacagacgcggcccaaagactcccaatattgacgtctacgaccagcacgca
tcttttgtagcgccgaagaccatacgcacaggtcaaggagacaaagaagctattatctct
ggtgatcgtattgtcatagctactggttctcgtccattcatcgaccaaaaagtcatcgac
tcaggcgtgcattattacaccaacgagaccatcatgcgtttagaatccttacccacgtct
atggtggtgatgggcggcggatacattgccatggaatttgctcatgtctttgatgctctc
ggggtgaaagttaccgtagtaaaccgttctcagaagctcctgcgacagcttgattccgat
atttctgatcgattcactgagatcactaaagaaaaactagattgcaggctaggccgcact
atccaatccatcacagaaaacgacggaacggttacgcttactttggatgatggatccaca
gcagaaggagaagtcttcctcgtagccaccggccgtatccccaatggcgacctcatggac
ctagataacgctggcgtagaaatggatggtcgccggattaaggttgaccaatacggacgt
accacggctcctgatgtttgggctttgggcgatgtatcctcaccgtatttgctcaaacac
gtagctaatgctgaaatgcgggcagtaaaacataaccttttgcacccagaagatcttcag
tccatgcctcacgagaatgtcccggctgcggtttttacccacccacaaatcggaacagtt
ggtttaaccgaagatgaggctagagccgccggatacaacatcaccgttaagattcagaat
tatggcgatgttgcctatggttgggcaatggaagacaccgaacattttgtcaaactcatc
gcagacaaagataccgggctgctgctgggcgctcattttatcggtccccaggcttccacg
ctagtgcagcaactcattaccgttatggcctttaaacttgatgttcgtgatgttgccact
aagcagtactggatccacccggcactgccagagttaacagaaaatgccctcttgggtctt
gatttctcttag

DBGET integrated database retrieval system