KEGG   Corynebacterium pseudotuberculosis 267: Cp267_1963Help
Entry
Cp267_1963        CDS       T01934                                 

Gene name
adhA
Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
cor00010  Glycolysis / Gluconeogenesis
cor00071  Fatty acid degradation
cor00350  Tyrosine metabolism
cor00625  Chloroalkane and chloroalkene degradation
cor00626  Naphthalene degradation
cor01100  Metabolic pathways
cor01110  Biosynthesis of secondary metabolites
cor01120  Microbial metabolism in diverse environments
cor01130  Biosynthesis of antibiotics
cor01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp267_1963 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    Cp267_1963 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cp267_1963 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cp267_1963 (adhA)
   00626 Naphthalene degradation
    Cp267_1963 (adhA)
Enzymes [BR:cor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cp267_1963 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short Methyltransf_25 TrkA_N Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AFH52840
Position
complement(2073797..2074834)
Genome map
AA seq 345 aa AA seqDB search
MKTDFPEAFTAAVVDNFGPELNIHDVVLPEPGPNQALVKLVASGICHTDLHAAEGDWPVK
PEPPFVPGHEGVGEVVKLGPGHHRVQLGDMVGNVWLWSACGECEYCRTGRETLCNDAEYG
GYTVDGSFGEYMLVDTRYCARIPEGSDPVEVAPILCAGVTVYKGLKETECKPGQYMVISG
IGGLGHIAVQYAVAMGMRVIAVDIADEKLELARKHGAEFAVNALKEDPVESINAFTSGGA
HGVLVTAVHPQAFGQAIGMARKGGTIVFNGLPPGEFPAPIFEIVFKGLTIRGSLVGTRQD
LEEALDFYARGMIKPTVTECKLGDVNSVFADMHKGTVDGRMAIRY
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaccgatttccctgaggccttcaccgccgctgtagttgacaactttggccctgaa
ctcaatatccacgatgttgttttgcccgagccgggacctaatcaggcattggtaaagctg
gtggcctctggtatttgccatacagatcttcatgcggcggaaggggactggccggtaaaa
ccggaaccgccttttgtccccgggcatgaaggcgtgggggaagttgtgaaattgggaccc
ggccatcatcgcgtgcaacttggagacatggtgggcaacgtttggctttggtccgcctgt
ggggagtgcgagtactgccgcaccggacgtgaaaccctttgcaatgacgccgaatatggc
ggctatacggtcgacggctcttttggtgaatacatgctggtagatacccgctactgtgcg
cgtattccagaaggctccgatccagttgaagtggcccccatcttgtgtgccggcgtgacc
gtgtacaaaggcctcaaagaaaccgagtgtaagccgggccagtacatggtgatttccggc
atcggtggcctagggcatatcgctgtgcagtatgcggtggctatgggaatgcgagtgatc
gctgtggatattgcagatgagaagctcgagctggcgcgtaagcacggtgcagaatttgca
gtcaatgcgttgaaggaagacccggttgagtcgatcaacgcatttacctcaggtggtgcg
catggcgttttggtcactgccgtgcacccgcaggcgtttggacaagccatcgggatggcc
agaaaaggcggaaccatcgtatttaatgggcttcctccaggagagttcccggcaccgatt
tttgagattgtgttcaaggggttaactattcgcggttcattggtgggaacgcgccaggac
ctagaagaagccctggatttctatgcacgcggaatgatcaaaccgaccgttacggaatgc
aagcttggcgacgtcaacagtgtcttcgccgatatgcataaaggcacggttgatggtcgc
atggctattaggtattaa

DBGET integrated database retrieval system