KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_0255Help
Entry
Cp4202_0255       CDS       T02053                                 

Gene name
gpmA
Definition
(GenBank) Phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
cos00010  Glycolysis / Gluconeogenesis
cos00260  Glycine, serine and threonine metabolism
cos00680  Methane metabolism
cos01100  Metabolic pathways
cos01110  Biosynthesis of secondary metabolites
cos01120  Microbial metabolism in diverse environments
cos01130  Biosynthesis of antibiotics
cos01200  Carbon metabolism
cos01230  Biosynthesis of amino acids
Module
cos_M00002  Glycolysis, core module involving three-carbon compounds
cos_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cos00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp4202_0255 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Cp4202_0255 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp4202_0255 (gpmA)
Enzymes [BR:cos01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cp4202_0255 (gpmA)
Membrane trafficking [BR:cos04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Cp4202_0255 (gpmA)
Exosome [BR:cos04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cp4202_0255 (gpmA)
  Exosomal proteins of melanoma cells
   Cp4202_0255 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEP69527
Position
274007..274753
Genome map
AA seq 248 aa AA seqDB search
MTIGKLILLRHGQSEWNASNQFTGWVDVNLTEQGEAEAKRGGEMLKQQDVLPTVVYTSLL
RRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKDKYGADQFMEWRRSYG
TPPPELEDSSEFSQANDPRYADLSQVPRTECLKDVVERFVPYFEEEILPRAKKGETVLIA
AHGNSLRALVKHLDNISDADIAELNIPTGIPLVYELDQEGKVLNPGGTYLDPEAAAAGAA
AVAAQGGK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactatcggaaaactgattcttctccgccacggacaaagcgagtggaacgcctccaac
cagttcacgggttgggtggacgttaaccttactgagcaaggcgaggccgaggccaagcgc
ggcggcgagatgctgaagcaacaagatgttttgccaactgttgtttatacttctcttctt
cgtcgcgcaatccgcaccgccaacatcgcactcaacgcggcggatcgtcattggatcccg
gtcgtgcgcgattggcgcctcaacgagcgtcactatggtgcgttgcagggtctgaacaag
gctgagaccaaggataagtatggcgcagatcagttcatggaatggcgccgttcttacggc
acccctcctccggagttggaagactcaagtgagttttctcaggcaaacgacccccgctac
gccgatctgtctcaggttcctcgcacggaatgcctcaaggacgttgtagaacgttttgtg
ccttattttgaagaggaaattttgccacgggcgaaaaagggcgagactgtcctcatcgca
gcgcatggtaattccttgcgtgcattggtcaaacaccttgacaatatctcggatgcagat
atcgcggagctgaatattcctaccggaattccgctggtatacgagctggaccaggaagga
aaggttcttaacccgggtggtacctaccttgatccagaggcagcggcagcaggagctgcg
gcagttgctgcgcaaggcggcaaataa

DBGET integrated database retrieval system