KEGG   Corynebacterium pseudotuberculosis 42/02-A: Cp4202_1291Help
Entry
Cp4202_1291       CDS       T02053                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cos  Corynebacterium pseudotuberculosis 42/02-A
Pathway
cos00900  Terpenoid backbone biosynthesis
cos01100  Metabolic pathways
cos01110  Biosynthesis of secondary metabolites
cos01130  Biosynthesis of antibiotics
Module
cos_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:cos00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cp4202_1291 (dxr)
Enzymes [BR:cos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Cp4202_1291 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Pro-rich_19
Motif
Other DBs
NCBI-ProteinID: AEP70544
Position
complement(1425355..1426521)
Genome map
AA seq 388 aa AA seqDB search
MSKRILILGSTGSIGTQALEVIEANPERFQVVGIAAGGRDPRAVIEQARILGLPAHAVAV
ADPQAAHAVSAALGNQILSGEDAATRLVQSIEADTVLNGLVGSLGLSATLATIESGENLA
LANKESLVAGGRFVTSKARPGQIIPVDSEHSAMAQCLRSGARSEVARFVLTASGGPFRGW
TRQQMWDVTPQQAAAHPTWSMGQMNTLNSATLVNKGLELIEATLLFDVPADHIDVTVHPQ
SIVHSMITFSDGATIAQASPPSMKLPISHALDWPARVPDAQPSLDFSSASSWDFMPVDNQ
AFPAIRLAREVALAGGTYPAVYNAANEEAAAAFLAGRIRFPHIVDTVEEIVQNASDFAGE
PHSVDEILAHEKEARRRANLFVDKLAQK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagcgaattttaattctaggcagcacgggttctatcggtactcaggcccttgaa
gttattgaggcaaatccggagcggtttcaggtcgttggaattgcggcgggcggacgcgat
ccgcgcgccgtaatagagcaggcaagaatattgggccttccggctcatgctgttgccgtt
gctgatcctcaagcggcgcatgctgtttctgcagcactcgggaatcagattttgagtggg
gaagatgctgctaccaggcttgttcagagcatagaagctgacactgttttgaatggttta
gtagggtcgctgggactctcagcaacattggccaccattgagagcggggagaatcttgcg
ttggctaataaagagtccttggtagctggcgggagatttgttactagcaaagcgcgtccg
gggcagattatccccgtggattctgagcactcggcgatggctcagtgtttgcgctctggg
gctcgttccgaggttgcgcggtttgtgctaaccgcttcaggtggaccgtttagggggtgg
actaggcaacagatgtgggatgtgactcctcagcaagctgcggcgcaccccacgtggtcg
atgggacaaatgaatacactaaactcggcgactttggtaaataaaggactggaattaata
gaagcaacattgcttttcgacgtccccgcagatcacattgacgtcacggtgcatccacag
tcgatagtgcattccatgattactttttcggatggtgcgactatcgctcaggcgtctcct
ccttctatgaaactgccgatttctcatgccttggattggccagcacgcgttccagacgca
cagcctagccttgatttttcttctgcaagttcttgggattttatgcctgtggataatcaa
gctttccctgccattcggcttgcccgtgaagttgcactggcagggggaacctatccggcg
gtatataacgcggctaatgaagaagccgccgctgcttttcttgccggcaggattcggttc
cctcatatcgtggatactgttgaagaaatcgtccagaatgcttctgattttgcgggagag
ccacattccgtagacgagattttggcgcacgagaaagaagcccgacgtcgagcaaatcta
tttgtggataaactagctcagaaatag

DBGET integrated database retrieval system