KEGG   Candida orthopsilosis: CORT_0A02700Help
Entry
CORT_0A02700      CDS       T02488                                 

Definition
(RefSeq) Ymx6 NADH dehydrogenase
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
cot  Candida orthopsilosis
Brite
KEGG Orthology (KO) [BR:cot00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CORT_0A02700
Enzymes [BR:cot01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     CORT_0A02700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox TrkA_N
Motif
Other DBs
NCBI-GeneID: 14536836
NCBI-ProteinID: XP_003866100
UniProt: H8WW36
Position
1:586540..588255
Genome map
AA seq 571 aa AA seqDB search
MFSRIATRRFIPTPFSTRLTTGTRLNLSAPRFTKSYSTVNSPSPPHPTYTSLVLNLFKYA
LGAGALGAAGFVGFVGYKIYAETHPGKQEPQSPTFSSGERKKTLVLLGSGWGSVALLKNL
DTTLYNVVLVSPRNYFLFTPLLPSVPTGTVDMKSIIEPVRAITRLCKGQVVYYEAEAVDI
DPETNTLKIQQSTTVHSGHSKQSSASTKSEKIGDGNIEYINATLQYDYLVVGIGAQPSTF
GLPGVAQHSTFVKEVGDSLRIKKTLIDLVEAANLLPENDKERKRLLHVIVCGGGPTGVEA
AGEIQDYIDQDLKKWMPEVAKDLKVTLIESQPKVLHTFNPKLVEYTNQVFQDTNINLVTS
ARINSVDDKYCTVFHKQSKDTEIVPYGMLIWATGNATRDFTHVLMDKVEEQKNAKRGFLV
DKYLKLQGSSNIFALGDCTFTKYPPTAQVAHQQGEYLANYFDKLQKLSSLRYKIDHEQNP
SETLKSRAVRLEKNLPHFIYNYQGSLAYIGSEKAVADLAWGSWSNVSTGGNLTYLFWRSA
YIYMCLSVKNQILICIDWLKVYAFGRDCSRE
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgtttagcagaattgcaactaggaggtttatacctaccccctttagtacaaggttaact
accggcacaagacttaatctatcggcaccacgtttcaccaagtcatattccacggtgaat
ctgccactgccaccacatcctacttatacttcacttgttctcaatttattcaaatatgct
cttggtgctggtgcgttgggagcagccgggtttgtgggttttgttggatacaagatttat
gctgaaactcatcctggtaaacaagagccacaatctcccactttctccagtggtgaacgc
aaaaagacattggttcttttaggttctggatggggatcagtcgcattattaaagaatttg
gatactactttatacaatgtggttttagtttcaccaagaaactatttcttatttactccg
ttattacctagtgtgcctactgggactgttgacatgaagtccattattgaaccagttaga
gcaattactaggttgtgtaaaggacaagtggtgtattacgaagcagaagctgttgatatt
gaccctgaaacaaacacattgaagatccaacaatcaacaacggtacattcgggtcattca
aaacaaagttcagcatcaactaaatcggagaaaattggtgatggaaacatcgaatatatt
aatgctacacttcaatacgattatttggttgttggaattggtgctcaaccatcaacattt
ggtttaccaggagttgctcaacactcaacctttgttaaagaagttggtgattcattgagg
atcaaaaagacattgattgatctagttgaagcagccaatttattaccagaaaatgataaa
gagcgtaaacgattattacatgttattgtatgtggtggtggtccaactggtgttgaagcc
gctggtgaaattcaagattatattgatcaagatttgaaaaaatggatgcctgaagttgct
aaagatttaaaagtaactcttattgaatcgcaaccaaaagtattacatacattcaaccct
aaattggttgaatatactaatcaagttttccaagatacaaatatcaatcttgttacgagt
gctagaatcaattcagttgatgataaatattgtactgttttccataaacaatccaaagat
actgagattgttccctatggtatgcttatatgggccactggtaatgccactagagacttc
actcacgtattgatggacaaagtagaagaacaaaagaatgccaaacgtggattccttgtt
gacaaatatttgaaattacaaggatcatcaaacatctttgccttgggagattgtacattt
accaagtatccacccacagcacaagttgctcatcaacaaggtgaatacttggccaattat
ttcgataagttacaaaaattatcaagcttgaggtacaaaattgatcatgaacaaaaccca
tcagaaacattgaaatcacgagctgtcagattagaaaagaatttaccacatttcatttac
aattatcaaggatcattggcttatattggaagtgagaaagcagtggcagatttggcttgg
ggctcgtggtcaaatgtatcgactggtggtaatttgacttatttgttttggagatcagct
tatatttacatgtgtctttcggtaaagaatcaaatcttgatttgcattgattggttgaag
gtgtatgcttttggaagagattgctcaagggagtag

DBGET integrated database retrieval system