KEGG   Candida orthopsilosis: CORT_0B00150Help
Entry
CORT_0B00150      CDS       T02488                                 

Definition
(RefSeq) Trp4 protein
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
cot  Candida orthopsilosis
Pathway
cot00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cot01100  Metabolic pathways
cot01110  Biosynthesis of secondary metabolites
cot01130  Biosynthesis of antibiotics
cot01230  Biosynthesis of amino acids
Module
cot_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cot00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CORT_0B00150
Enzymes [BR:cot01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     CORT_0B00150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 14538137
NCBI-ProteinID: XP_003867176
UniProt: H8WZ70
Position
2:16725..17837
Genome map
AA seq 370 aa AA seqDB search
MTVQSPTKDKVLTPYIKSLVQNPPHFTPDDLASVIKLIFTDRASEIQVAAFLTSLRQREL
DHESVYIAAAVKTVLEFAETIEDHLVDEAGYIDIVGTGGDGQNTFNVSTSSAIVAAGMGL
PVCKHGGKASTSTSGSGDLLKSLGVDLAKINVVTLPDIVKKSKFCFLFAPSFHPGMGLVA
NVRAQLGVPTIFNILGPLINPIPIQSRILGVYSEKLGENYAQAASILAKKSHIHKRTMVV
YGECVLDEIAPTGYTKIWLVERDGEIKRDRISPKDFGLREHPLEAVRSGTPDENAEILNH
ILKQDEDEYKVREENSNAYVDYILLNTAALAYVSGICDNWVDGVKLAKESLTSGEALKAL
EDLIKAIDCV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgactgtacaaagcccgacaaaggacaaggttctcacaccttatatcaaatcattagtt
cagaaccctcctcattttactccagatgatttggcatcggtaataaagcttatatttacc
gaccgtgcgtctgaaattcaagttgcagcatttttgacttcattgagacaacgcgaattg
gaccacgagtcagtttatattgctgctgcagttaaaacagttttagagtttgcagagact
atagaggatcatttagttgatgaagcaggttacatagacattgttggtactggaggagat
ggtcaaaacacattcaatgtatcaacatcatcagctattgttgctgcaggaatgggccta
cctgtatgcaaacacggcggaaaagccagcacatctacttccggatctggagacttgtta
aagtctttgggtgttgatttagccaaaataaatgtggtaactttgccagatattgtgaaa
aaatcaaaattctgtttcttgtttgcaccatcattccaccctggaatggggctcgtggcg
aatgtgagagcacaacttggagtaccaacgattttcaacatattgggtccattgattaat
ccaattcctattcagtcgagaatcttgggtgtttatagcgaaaagttgggcgaaaactat
gctcaagctgcctccatacttgcaaagaagagtcatatacacaaacgtacaatggttgta
tatggggaatgtgttttggacgaaattgcaccaaccggttatacaaagatctggttagtt
gaaagagatggagagattaaaagggatcgcatttcacccaaggattttggactccgtgaa
catccattagaagctgtaaggtcagggactcccgatgaaaacgctgaaatactaaaccat
atattgaaacaagatgaagatgagtacaaagtgcgtgaggaaaatagtaatgcatatgtg
gactacattttgctaaatactgccgctcttgcttatgtatcaggcatttgtgataactgg
gtcgatggtgtaaaattagcaaaggagtctttgacaagtggggaggcgttgaaggcgttg
gaggatttaataaaagcaatagattgtgtatag

DBGET integrated database retrieval system